StarFunc result for job id P10276

User Input

>input (462 residues)
MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGYSTPSPAT
IETQSSSSEEIVPSPPSPPPLPRIYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNM
VYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEVPKPECSESYTL
TPEVGELIEKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKTV
EFAKQLPGFTTLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNA
GFGPLTDLVFAFANQLLPLEMDDAETGLLSAICLICGDRQDLEQPDRVDMLQEPLLEALK
VYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGL
DTLSGQPGGGGRDGGGLAPPPGSCSPSLSPSSNRSSPATHSP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0G2JW78	0.920	0.920	2.638E-61	462	0.985	0.985	A0A0G2JW78.pdb.gz	A0A0G2JW78_RAT Retinoic acid receptor, alpha OS=Rattus norvegicus OX=10116 GN=Rara PE=3 SV=1
2	AFDB:F1D8N9	0.560	0.566	1.046E-57	457	0.898	0.908	F1D8N9.pdb.gz	F1D8N9_HUMAN Retinoic acid nuclear receptor alpha variant 2 OS=Homo sapiens OX=9606 GN=NR1B1 PE=2 SV=1
3	AFDB:A8MUP8	0.561	0.542	4.941E-56	478	0.892	0.862	A8MUP8.pdb.gz	A8MUP8_HUMAN Retinoic acid receptor alpha OS=Homo sapiens OX=9606 GN=RARA PE=1 SV=1
4	AFDB:Q15156	0.551	0.322	1.005E-54	797	0.870	0.504	Q15156.pdb.gz	Q15156_HUMAN PML-RAR protein OS=Homo sapiens OX=9606 GN=PML-RAR PE=1 SV=1
5	AFDB:Q7ZTI3	0.708	0.713	2.135E-54	458	0.779	0.786	Q7ZTI3.pdb.gz	RARAB_DANRE Retinoic acid receptor alpha-B OS=Danio rerio OX=7955 GN=rarab PE=2 SV=1
6	AFDB:P22448	0.743	0.754	1.435E-53	455	0.777	0.789	P22448.pdb.gz	RARB_CHICK Retinoic acid receptor beta OS=Gallus gallus OX=9031 GN=RARB PE=2 SV=2
7	AFDB:Q90271	0.754	0.783	2.046E-53	444	0.777	0.809	Q90271.pdb.gz	RARAA_DANRE Retinoic acid receptor alpha-A OS=Danio rerio OX=7955 GN=raraa PE=2 SV=2
8	AFDB:P22605	0.566	0.544	1.642E-52	482	0.779	0.747	P22605.pdb.gz	RARB_MOUSE Retinoic acid receptor beta OS=Mus musculus OX=10090 GN=Rarb PE=1 SV=1
9	AFDB:D3ZF61	0.559	0.564	8.855E-51	458	0.697	0.703	D3ZF61.pdb.gz	D3ZF61_RAT Retinoic acid receptor, gamma OS=Rattus norvegicus OX=10116 GN=Rarg PE=3 SV=1
10	AFDB:F1D8S6	0.544	0.561	1.155E-50	448	0.736	0.759	F1D8S6.pdb.gz	F1D8S6_HUMAN Retinoic acid receptor beta variant 1 OS=Homo sapiens OX=9606 GN=NR1B2 PE=2 SV=1
11	PDB:6fx0A	0.510	0.986	6.053E-29	238	0.429	0.832	6fx0A.pdb.gz	Structure-based design of Trifarotene (CD5789), a potent and selective RAR gamma agonist for the treatment of acne.
12	PDB:3dzyA	0.567	0.841	4.930E-18	302	0.227	0.348	3dzyA.pdb.gz	Structure of the intact PPAR-gamma-RXR- nuclear receptor complex on DNA.
13	PDB:1g2nA	0.373	0.679	1.976E-7	246	0.139	0.260	1g2nA.pdb.gz	Crystal structure of the ligand-binding domain of the ultraspiracle protein USP, the ortholog of retinoid X receptors in insects.
14	PDB:7kw7F	0.359	0.607	6.852E-5	259	0.093	0.166	7kw7F.pdb.gz	Structure of Hsp90-Hsp70-Hop-GR reveals the Hsp90 client-loading mechanism.
15	PDB:2jcdA	0.111	0.145	1.027	315	0.056	0.083	2jcdA.pdb.gz	Structure and Action of the N-Oxygenase Aurf from Streptomyces Thioluteus.
16	PDB:3n37A	0.158	0.219	1.074	284	0.063	0.102	3n37A.pdb.gz	Structural basis for activation of class Ib ribonucleotide reductase.
17	PDB:1ggqA	0.081	0.171	1.173	162	0.048	0.136	1ggqA.pdb.gz
18	PDB:4alyA	0.105	0.172	1.173	211	0.056	0.123	4alyA.pdb.gz
19	PDB:7khro	0.089	0.209	1.530	151	0.037	0.113	7khro.pdb.gz	Molecular basis of V-ATPase inhibition by bafilomycin A1.
20	PDB:1is2A	0.100	0.078	1.600	637	0.087	0.063	1is2A.pdb.gz	Three-dimensional structure of the flavoenzyme acyl-CoA oxidase-II from rat liver, the peroxisomal counterpart of mitochondrial acyl-CoA dehydrogenase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JW78	937	462	0.985	0.985	A0A0G2JW78_RAT Retinoic acid receptor, alpha OS=Rattus norvegicus OX=10116 GN=Rara PE=3 SV=1
2	A0A8I6A7Z0	709	455	0.762	0.774	A0A8I6A7Z0_RAT Retinoic acid receptor, beta OS=Rattus norvegicus OX=10116 GN=Rarb PE=3 SV=1
3	A0A8I6AIB6	660	408	0.693	0.784	A0A8I6AIB6_RAT Retinoic acid receptor, beta OS=Rattus norvegicus OX=10116 GN=Rarb PE=3 SV=1
4	A2T928	607	489	0.658	0.622	RARGB_DANRE Retinoic acid receptor gamma-B OS=Danio rerio OX=7955 GN=rargb PE=2 SV=1
5	A8K3H3	601	454	0.716	0.729	A8K3H3_HUMAN Retinoic acid nuclear receptor gamma variant 1 OS=Homo sapiens OX=9606 GN=RARG PE=2 SV=1
6	A8MUP8	712	478	0.885	0.856	A8MUP8_HUMAN Retinoic acid receptor alpha OS=Homo sapiens OX=9606 GN=RARA PE=1 SV=1
7	D3ZF61	594	458	0.699	0.705	D3ZF61_RAT Retinoic acid receptor, gamma OS=Rattus norvegicus OX=10116 GN=Rarg PE=3 SV=1
8	D3ZFD9	662	448	0.693	0.714	D3ZFD9_RAT Retinoic acid receptor, beta OS=Rattus norvegicus OX=10116 GN=Rarb PE=3 SV=2
9	D3ZWV0	588	485	0.656	0.625	D3ZWV0_RAT Retinoic acid receptor, gamma OS=Rattus norvegicus OX=10116 GN=Rarg PE=3 SV=1
10	E7BBH7	615	502	0.660	0.608	E7BBH7_ONCMY Retinoic acid receptor, gamma, variant a OS=Oncorhynchus mykiss OX=8022 GN=rarg a PE=2 SV=1
11	F1D8N9	828	457	0.887	0.897	F1D8N9_HUMAN Retinoic acid nuclear receptor alpha variant 2 OS=Homo sapiens OX=9606 GN=NR1B1 PE=2 SV=1
12	F1D8S6	672	448	0.714	0.737	F1D8S6_HUMAN Retinoic acid receptor beta variant 1 OS=Homo sapiens OX=9606 GN=NR1B2 PE=2 SV=1
13	P10276	950	462	1.000	1.000	RARA_HUMAN Retinoic acid receptor alpha OS=Homo sapiens OX=9606 GN=RARA PE=1 SV=2
14	P10826	716	455	0.779	0.791	RARB_HUMAN Retinoic acid receptor beta OS=Homo sapiens OX=9606 GN=RARB PE=1 SV=2
15	P11416	936	462	0.983	0.983	RARA_MOUSE Retinoic acid receptor alpha OS=Mus musculus OX=10090 GN=Rara PE=1 SV=1
16	P13631	601	454	0.716	0.729	RARG_HUMAN Retinoic acid receptor gamma OS=Homo sapiens OX=9606 GN=RARG PE=1 SV=1
17	P18911	599	458	0.703	0.710	RARG_MOUSE Retinoic acid receptor gamma OS=Mus musculus OX=10090 GN=Rarg PE=1 SV=3
18	P22448	717	455	0.777	0.789	RARB_CHICK Retinoic acid receptor beta OS=Gallus gallus OX=9031 GN=RARB PE=2 SV=2
19	P22605	691	482	0.755	0.724	RARB_MOUSE Retinoic acid receptor beta OS=Mus musculus OX=10090 GN=Rarb PE=1 SV=1
20	P51126	736	458	0.820	0.828	RARA_XENLA Retinoic acid receptor alpha OS=Xenopus laevis OX=8355 GN=rara PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00104 Hormone_recep	1.2e-18	79.1	Ligand-binding domain of nuclear hormone receptor
2	PF00105 zf-C4	4.5e-29	112.0	Zinc finger, C4 type (two domains)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 482537.XP_008590427.1

Rank	PPI partner	STRING score	Description
1	482537.XP_008572393.1	0.997	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 5 mRNAs, 29 Proteins, and 72% coverage of the annotated genomic feature by RNAseq alignments
2	482537.XP_008569029.1	0.996	Nuclear receptor corepressor 1 isoform X1
3	482537.XP_008565383.1	0.991	Nuclear receptor coactivator 2
4	482537.XP_008568838.1	0.991	Nuclear receptor coactivator 1 isoform X1
5	482537.XP_008567885.1	0.990	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 16 Proteins, and 90% coverage of the annotated genomic feature by RNAseq alignments
6	482537.XP_008580040.1	0.978	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 mRNAs, 9 Proteins, and 83% coverage of the annotated genomic feature by RNAseq alignments
7	482537.XP_008590085.1	0.976	Retinoic acid receptor RXR-gamma
8	482537.XP_008576051.1	0.971	Zinc finger and BTB domain-containing protein 16
9	482537.XP_008584137.1	0.969	Nuclear receptor corepressor 2 isoform X1
10	482537.XP_008576836.1	0.949	Nuclear receptor-interacting protein 1
11	482537.XP_008572993.1	0.938	Nuclear receptor coactivator 3
12	482537.XP_008572904.1	0.910	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 mRNA, 4 Proteins, and 57% coverage of the annotated genomic feature by RNAseq alignments
13	482537.XP_008569466.1	0.885	Nuclear receptor coactivator 6
14	482537.XP_008563735.1	0.872	Mediator of RNA polymerase II transcription subunit 1-like
15	482537.XP_008571825.1	0.872	Mediator of RNA polymerase II transcription subunit 1
16	482537.XP_008582394.1	0.865	Krueppel-like factor 5
17	482537.XP_008577301.1	0.856	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 13 mRNAs, 33 Proteins, and 98% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
18	482537.XP_008574864.1	0.807	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 5 mRNAs, 3 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
19	482537.XP_008568633.1	0.796	Cellular retinoic acid-binding protein 2
20	482537.XP_008591743.1	0.770	Histone acetyltransferase KAT2B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0000981	1.000	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0005515	0.999	protein binding
GO:0043565	0.998	sequence-specific DNA binding
GO:0038023	0.997	signaling receptor activity
GO:0098531	0.995	ligand-activated transcription factor activity
GO:0004879	0.994	nuclear receptor activity
GO:0003690	0.954	double-stranded DNA binding
GO:1990837	0.928	sequence-specific double-stranded DNA binding
GO:0008134	0.885	transcription factor binding
GO:0000976	0.828	transcription cis-regulatory region binding
GO:0000977	0.387	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0019899	0.341	enzyme binding
GO:0140297	0.307	DNA-binding transcription factor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.995	response to stimulus
GO:0050794	0.992	regulation of cellular process
GO:0010468	0.990	regulation of gene expression
GO:0009987	0.986	cellular process
GO:0009889	0.985	regulation of biosynthetic process
GO:0048522	0.983	positive regulation of cellular process
GO:0031323	0.947	regulation of cellular metabolic process
GO:0051171	0.938	regulation of nitrogen compound metabolic process
GO:0080090	0.931	regulation of primary metabolic process
GO:0042221	0.926	response to chemical
GO:0048856	0.902	anatomical structure development
GO:0032501	0.900	multicellular organismal process
GO:0010556	0.900	regulation of macromolecule biosynthetic process
GO:0031326	0.896	regulation of cellular biosynthetic process
GO:0010033	0.883	response to organic substance
GO:0019219	0.857	regulation of nucleobase-containing compound metabolic process
GO:0007275	0.792	multicellular organism development
GO:0071704	0.791	organic substance metabolic process
GO:0009893	0.784	positive regulation of metabolic process
GO:0070887	0.782	cellular response to chemical stimulus
GO:0051252	0.782	regulation of RNA metabolic process
GO:0006355	0.772	regulation of DNA-templated transcription
GO:1901700	0.761	response to oxygen-containing compound
GO:0044238	0.748	primary metabolic process
GO:0048519	0.730	negative regulation of biological process
GO:0010604	0.720	positive regulation of macromolecule metabolic process
GO:0051173	0.693	positive regulation of nitrogen compound metabolic process
GO:0048731	0.665	system development
GO:0006807	0.655	nitrogen compound metabolic process
GO:0048523	0.645	negative regulation of cellular process
GO:0051239	0.633	regulation of multicellular organismal process
GO:0044237	0.597	cellular metabolic process
GO:0050793	0.596	regulation of developmental process
GO:0043170	0.589	macromolecule metabolic process
GO:0031325	0.589	positive regulation of cellular metabolic process
GO:0007154	0.564	cell communication
GO:0006357	0.542	regulation of transcription by RNA polymerase II
GO:0023052	0.514	signaling
GO:0048513	0.502	animal organ development
GO:0033993	0.463	response to lipid
GO:0007165	0.456	signal transduction
GO:0045935	0.449	positive regulation of nucleobase-containing compound metabolic process
GO:0010605	0.446	negative regulation of macromolecule metabolic process
GO:0010557	0.439	positive regulation of macromolecule biosynthetic process
GO:0051254	0.439	positive regulation of RNA metabolic process
GO:0031328	0.438	positive regulation of cellular biosynthetic process
GO:2000026	0.435	regulation of multicellular organismal development
GO:0051172	0.434	negative regulation of nitrogen compound metabolic process
GO:0045893	0.419	positive regulation of DNA-templated transcription
GO:0032526	0.403	response to retinoic acid
GO:0031324	0.393	negative regulation of cellular metabolic process
GO:0007399	0.378	nervous system development
GO:0051960	0.374	regulation of nervous system development
GO:0060322	0.367	head development
GO:0048583	0.364	regulation of response to stimulus
GO:0007417	0.358	central nervous system development
GO:0071310	0.352	cellular response to organic substance
GO:0045944	0.324	positive regulation of transcription by RNA polymerase II
GO:0071840	0.315	cellular component organization or biogenesis
GO:0023051	0.312	regulation of signaling
GO:0010646	0.312	regulation of cell communication
GO:0042127	0.311	regulation of cell population proliferation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.998	nucleoplasm
GO:0032991	0.951	protein-containing complex
GO:0005737	0.920	cytoplasm
GO:0005829	0.720	cytosol
GO:0043232	0.361	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]