StarFunc result for job id P10321

User Input

>input (366 residues)
MRVMAPRALLLLLSGGLALTETWACSHSMRYFDTAVSRPGRGEPRFISVGYVDDTQFVRF
DSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQADRVSLRNLRGYYNQSEDGSHTLQ
RMSGCDLGPDGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAAQITQRKLEAARAAEQL
RAYLEGTCVEWLRRYLENGKETLQRAEPPKTHVTHHPLSDHEATLRCWALGFYPAEITLT
WQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRYTCHMQHEGLQEPLTLSWEP
SSQPTIPIMGIVAGLAVLVVLAVLGAVVTAMMCRRKSSGGKGGSCSQAACSNSAQGSDES
LITCKA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P10321	1.000	1.000	7.085E-69	366	1.000	1.000	P10321.pdb.gz	HLAC_HUMAN HLA class I histocompatibility antigen, C alpha chain OS=Homo sapiens OX=9606 GN=HLA-C PE=1 SV=3
2	AFDB:A0A583ZBW8	0.840	0.840	3.337E-62	366	0.899	0.899	A0A583ZBW8.pdb.gz	A0A583ZBW8_HUMAN HLA-C protein OS=Homo sapiens OX=9606 GN=HLA-C PE=1 SV=1
3	AFDB:P01889	0.868	0.877	3.503E-61	362	0.855	0.865	P01889.pdb.gz	HLAB_HUMAN HLA class I histocompatibility antigen, B alpha chain OS=Homo sapiens OX=9606 GN=HLA-B PE=1 SV=3
4	AFDB:P01893	0.817	0.825	5.361E-59	362	0.803	0.812	P01893.pdb.gz	HLAH_HUMAN Putative HLA class I histocompatibility antigen, alpha chain H OS=Homo sapiens OX=9606 GN=HLA-H PE=5 SV=3
5	AFDB:P04439	0.874	0.877	8.717E-58	365	0.814	0.816	P04439.pdb.gz	HLAA_HUMAN HLA class I histocompatibility antigen, A alpha chain OS=Homo sapiens OX=9606 GN=HLA-A PE=1 SV=2
6	AFDB:P17693	0.852	0.920	6.962E-57	338	0.740	0.802	P17693.pdb.gz	HLAG_HUMAN HLA class I histocompatibility antigen, alpha chain G OS=Homo sapiens OX=9606 GN=HLA-G PE=1 SV=1
7	AFDB:P30511	0.840	0.887	3.792E-56	346	0.738	0.780	P30511.pdb.gz	HLAF_HUMAN HLA class I histocompatibility antigen, alpha chain F OS=Homo sapiens OX=9606 GN=HLA-F PE=1 SV=3
8	AFDB:Q95476	0.789	0.813	7.674E-55	355	0.702	0.724	Q95476.pdb.gz	Q95476_BOVIN MHC Class I (Fragment) OS=Bos taurus OX=9913 GN=JSP.1 PE=2 SV=1
9	AFDB:P01902	0.783	0.779	6.838E-54	368	0.656	0.652	P01902.pdb.gz	HA1D_MOUSE H-2 class I histocompatibility antigen, K-D alpha chain OS=Mus musculus OX=10090 GN=H2-K1 PE=1 SV=1
10	AFDB:P13747	0.766	0.782	2.834E-53	358	0.721	0.737	P13747.pdb.gz	HLAE_HUMAN HLA class I histocompatibility antigen, alpha chain E OS=Homo sapiens OX=9606 GN=HLA-E PE=1 SV=4
11	PDB:6d7gA	0.736	0.698	5.432E-45	386	0.626	0.593	6d7gA.pdb.gz
12	PDB:5j6hA	0.741	0.983	3.301E-44	275	0.568	0.756	5j6hA.pdb.gz	Recognition of the Major Histocompatibility Complex (MHC) Class Ib Molecule H2-Q10 by the Natural Killer Cell Receptor Ly49C.
13	PDB:6e1iA	0.745	0.702	3.301E-44	389	0.593	0.558	6e1iA.pdb.gz
14	PDB:6mp0A	0.728	0.687	2.106E-42	388	0.563	0.531	6mp0A.pdb.gz
15	PDB:2qriA	0.730	0.673	3.242E-41	398	0.544	0.500	2qriA.pdb.gz
16	PDB:3nwmA	0.729	0.695	1.499E-40	384	0.552	0.526	3nwmA.pdb.gz
17	PDB:3es6A	0.615	0.787	7.504E-26	277	0.268	0.354	3es6A.pdb.gz	Crystal structure of the novel complex formed between zinc alpha2-glycoprotein (ZAG) and prolactin-inducible protein (PIP) from human seminal plasma
18	PDB:6fgbA	0.604	0.807	1.141E-22	265	0.216	0.298	6fgbA.pdb.gz
19	PDB:3ov6A	0.601	0.587	2.840E-19	376	0.158	0.154	3ov6A.pdb.gz	The 2.5 A structure of CD1c in complex with a mycobacterial lipid reveals an open groove ideally suited for diverse antigen presentation
20	PDB:1cd1A	0.574	0.737	1.726E-18	273	0.169	0.227	1cd1A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A583ZBW8	0.0	619	366	0.899	0.899	A0A583ZBW8_HUMAN HLA-C protein OS=Homo sapiens OX=9606 GN=HLA-C PE=1 SV=1
2	P01889	0.0	579	362	0.850	0.859	HLAB_HUMAN HLA class I histocompatibility antigen, B alpha chain OS=Homo sapiens OX=9606 GN=HLA-B PE=1 SV=3
3	P01893	0.0	559	362	0.803	0.812	HLAH_HUMAN Putative HLA class I histocompatibility antigen, alpha chain H OS=Homo sapiens OX=9606 GN=HLA-H PE=5 SV=3
4	P04439	0.0	592	365	0.814	0.816	HLAA_HUMAN HLA class I histocompatibility antigen, A alpha chain OS=Homo sapiens OX=9606 GN=HLA-A PE=1 SV=2
5	P10321	0.0	757	366	1.000	1.000	HLAC_HUMAN HLA class I histocompatibility antigen, C alpha chain OS=Homo sapiens OX=9606 GN=HLA-C PE=1 SV=3
6	P13747	0.0	507	358	0.713	0.729	HLAE_HUMAN HLA class I histocompatibility antigen, alpha chain E OS=Homo sapiens OX=9606 GN=HLA-E PE=1 SV=4
7	P17693	0.0	545	338	0.710	0.769	HLAG_HUMAN HLA class I histocompatibility antigen, alpha chain G OS=Homo sapiens OX=9606 GN=HLA-G PE=1 SV=1
8	Q53YP1	0.0	629	366	0.913	0.913	Q53YP1_HUMAN HLA class I histocompatibility antigen OS=Homo sapiens OX=9606 GN=HLA-C PE=1 SV=1
9	Q5RIP0	0.0	633	366	0.910	0.910	Q5RIP0_HUMAN HLA class I histocompatibility antigen OS=Homo sapiens OX=9606 GN=HLA-C PE=1 SV=1
10	Q5SUL5	0.0	582	365	0.801	0.803	Q5SUL5_HUMAN HLA class I histocompatibility antigen OS=Homo sapiens OX=9606 GN=HLA-A PE=1 SV=1
11	Q7YQB1	0.0	613	366	0.921	0.921	Q7YQB1_HUMAN MHC class I antigen OS=Homo sapiens OX=9606 GN=HLA-C PE=1 SV=1
12	P30511	4.19e-180	504	346	0.732	0.775	HLAF_HUMAN HLA class I histocompatibility antigen, alpha chain F OS=Homo sapiens OX=9606 GN=HLA-F PE=1 SV=3
13	Q95476	3.40e-178	500	355	0.680	0.701	Q95476_BOVIN MHC Class I (Fragment) OS=Bos taurus OX=9913 GN=JSP.1 PE=2 SV=1
14	P01899	2.09e-170	481	362	0.689	0.696	HA11_MOUSE H-2 class I histocompatibility antigen, D-B alpha chain OS=Mus musculus OX=10090 GN=H2-D1 PE=1 SV=2
15	P01897	1.74e-167	473	362	0.680	0.688	HA1L_MOUSE H-2 class I histocompatibility antigen, L-D alpha chain OS=Mus musculus OX=10090 GN=H2-L PE=1 SV=2
16	P14426	6.36e-164	464	362	0.664	0.671	HA13_MOUSE H-2 class I histocompatibility antigen, D-K alpha chain OS=Mus musculus OX=10090 GN=H2-D1 PE=1 SV=1
17	P06339	1.28e-162	461	357	0.628	0.644	HA15_MOUSE H-2 class I histocompatibility antigen, D-37 alpha chain OS=Mus musculus OX=10090 GN=H2-T23 PE=1 SV=1
18	Q4KN81	2.97e-162	460	360	0.626	0.636	Q4KN81_MOUSE Histocompatibility 2, Q region locus 2 OS=Mus musculus OX=10090 GN=H2-Q2 PE=1 SV=1
19	P14427	1.50e-160	456	368	0.661	0.658	HA14_MOUSE H-2 class I histocompatibility antigen, D-P alpha chain OS=Mus musculus OX=10090 GN=H2-D1 PE=1 SV=1
20	P01901	2.16e-160	456	369	0.631	0.626	HA1B_MOUSE H-2 class I histocompatibility antigen, K-B alpha chain OS=Mus musculus OX=10090 GN=H2-K1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07654 C1-set	1.1e-10	53.0	Immunoglobulin C1-set domain
2	PF08205 C2-set_2	1	20.8	CD80-like C2-set immunoglobulin domain
3	PF00047 ig	34	16.0	Immunoglobulin domain
4	PF13927 Ig_3	0.84	21.6	Immunoglobulin domain
5	PF00129 MHC_I	2.3e-90	312.4	Class I Histocompatibility antigen, domains alpha 1 and 2
6	PF16497 MHC_I_3	18	16.2	MHC-I family domain
7	PF06623 MHC_I_C	1.9e-09	48.4	MHC_I C-terminus

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000365402

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000336769	0.999	Killer cell immunoglobulin-like receptor 2DL1
2	9606.ENSP00000342215	0.999	Killer cell immunoglobulin-like receptor 2DL3
3	9606.ENSP00000452780	0.999	Beta-2-microglobulin
4	9606.ENSP00000375608	0.995	Killer cell immunoglobulin-like receptor 3DL1
5	9606.ENSP00000399168	0.981	HLA class I histocompatibility antigen, B-7 alpha chain
6	9606.ENSP00000325525	0.978	Killer cell immunoglobulin-like receptor 3DL2
7	9606.ENSP00000365817	0.977	HLA class I histocompatibility antigen, alpha chain E
8	9606.ENSP00000235933	0.975	CD160 antigen
9	9606.ENSP00000259951	0.968	HLA class I histocompatibility antigen, alpha chain F
10	9606.ENSP00000291860	0.967	Killer cell immunoglobulin-like receptor 3DL3
11	9606.ENSP00000363976	0.965	HLA class II histocompatibility antigen, DM alpha chain
12	9606.ENSP00000375629	0.962	Leukocyte immunoglobulin-like receptor subfamily B member 2
13	9606.ENSP00000379873	0.962	HLA class I histocompatibility antigen, A-3 alpha chain
14	9606.ENSP00000364016	0.956	Proteasome subunit beta type-8
15	9606.ENSP00000229829	0.954	HLA class II histocompatibility antigen, DO alpha chain
16	9606.ENSP00000404833	0.942	Tapasin
17	9606.ENSP00000353099	0.940	HLA class II histocompatibility antigen, DRB1-15 beta chain
18	9606.ENSP00000252593	0.935	Bone marrow stromal antigen 2
19	9606.ENSP00000393566	0.935	HLA class II histocompatibility antigen, DP alpha 1 chain
20	9606.ENSP00000408146	0.934	HLA class II histocompatibility antigen, DP beta 1 chain

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003823	0.943	antigen binding
GO:0042277	0.934	peptide binding
GO:0042605	0.832	peptide antigen binding
GO:0044877	0.458	protein-containing complex binding
GO:0030881	0.327	beta-2-microglobulin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.989	regulation of cellular process
GO:0050896	0.986	response to stimulus
GO:0002682	0.986	regulation of immune system process
GO:0048518	0.985	positive regulation of biological process
GO:0002376	0.980	immune system process
GO:0050776	0.980	regulation of immune response
GO:0001914	0.973	regulation of T cell mediated cytotoxicity
GO:0002708	0.969	positive regulation of lymphocyte mediated immunity
GO:0009987	0.967	cellular process
GO:0048519	0.963	negative regulation of biological process
GO:0048522	0.963	positive regulation of cellular process
GO:0050778	0.956	positive regulation of immune response
GO:0006955	0.936	immune response
GO:0019882	0.915	antigen processing and presentation
GO:0048523	0.907	negative regulation of cellular process
GO:0048002	0.902	antigen processing and presentation of peptide antigen
GO:0031343	0.886	positive regulation of cell killing
GO:0001912	0.882	positive regulation of leukocyte mediated cytotoxicity
GO:0002824	0.880	positive regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains
GO:0051239	0.851	regulation of multicellular organismal process
GO:0002683	0.850	negative regulation of immune system process
GO:0032501	0.845	multicellular organismal process
GO:0001817	0.844	regulation of cytokine production
GO:0045088	0.833	regulation of innate immune response
GO:0002711	0.826	positive regulation of T cell mediated immunity
GO:0050777	0.797	negative regulation of immune response
GO:0006950	0.775	response to stress
GO:0006952	0.742	defense response
GO:0002252	0.726	immune effector process
GO:0042269	0.726	regulation of natural killer cell mediated cytotoxicity
GO:0002698	0.700	negative regulation of immune effector process
GO:0051240	0.686	positive regulation of multicellular organismal process
GO:0002250	0.681	adaptive immune response
GO:0002704	0.680	negative regulation of leukocyte mediated immunity
GO:0002707	0.673	negative regulation of lymphocyte mediated immunity
GO:0002449	0.661	lymphocyte mediated immunity
GO:0010604	0.638	positive regulation of macromolecule metabolic process
GO:0001911	0.637	negative regulation of leukocyte mediated cytotoxicity
GO:0001906	0.632	cell killing
GO:0009605	0.592	response to external stimulus
GO:0051716	0.511	cellular response to stimulus
GO:0001819	0.484	positive regulation of cytokine production
GO:0009607	0.471	response to biotic stimulus
GO:0043207	0.464	response to external biotic stimulus
GO:0032502	0.459	developmental process
GO:0051707	0.453	response to other organism
GO:0001909	0.424	leukocyte mediated cytotoxicity
GO:0031348	0.354	negative regulation of defense response
GO:0098542	0.325	defense response to other organism

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	0.999	endomembrane system
GO:0005886	0.999	plasma membrane
GO:0098588	0.999	bounding membrane of organelle
GO:0030659	0.999	cytoplasmic vesicle membrane
GO:0009986	0.997	cell surface
GO:0005783	0.992	endoplasmic reticulum
GO:0031984	0.991	organelle subcompartment
GO:0005789	0.983	endoplasmic reticulum membrane
GO:0030666	0.975	endocytic vesicle membrane
GO:0098553	0.974	lumenal side of endoplasmic reticulum membrane
GO:0030670	0.970	phagocytic vesicle membrane
GO:0098796	0.958	membrane protein complex
GO:0005794	0.953	Golgi apparatus
GO:0030662	0.946	coated vesicle membrane
GO:0030134	0.945	COPII-coated ER to Golgi transport vesicle
GO:0012507	0.939	ER to Golgi transport vesicle membrane
GO:0000139	0.933	Golgi membrane
GO:0031901	0.930	early endosome membrane
GO:0055038	0.929	recycling endosome membrane
GO:0005576	0.910	extracellular region
GO:0098797	0.858	plasma membrane protein complex
GO:0005615	0.715	extracellular space
GO:1903561	0.677	extracellular vesicle
GO:0042611	0.538	MHC protein complex
GO:0070062	0.526	extracellular exosome
GO:0009897	0.479	external side of plasma membrane
GO:0005634	0.352	nucleus
GO:0005765	0.315	lysosomal membrane
GO:0099503	0.306	secretory vesicle
GO:0030141	0.301	secretory granule

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]