StarFunc result for job id P10412

User Input

>input (219 residues)
MSETAPAAPAAPAPAEKTPVKKKARKSAGAAKRKASGPPVSELITKAVAASKERSGVSLA
ALKKALAAAGYDVEKNNSRIKLGLKSLVSKGTLVQTKGTGASGSFKLNKKAASGEAKPKA
KKAGAAKAKKPAGAAKKPKKATGAATPKKSAKKTPKKAKKPAAAAGAKKAKSPKKAKAAK
PKKAPKSPAKAKAVKPKAAKPKTAKPKAAKPKKAAAKKK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P15865	0.903	0.903	4.922E-27	219	0.954	0.954	P15865.pdb.gz	H14_RAT Histone H1.4 OS=Rattus norvegicus OX=10116 GN=H1-4 PE=1 SV=3
2	AFDB:P43277	0.715	0.709	3.404E-24	221	0.918	0.910	P43277.pdb.gz	H13_MOUSE Histone H1.3 OS=Mus musculus OX=10090 GN=H1-3 PE=1 SV=2
3	AFDB:P16402	0.788	0.781	3.985E-23	221	0.868	0.860	P16402.pdb.gz	H13_HUMAN Histone H1.3 OS=Homo sapiens OX=9606 GN=H1-3 PE=1 SV=2
4	AFDB:P02253	0.691	0.709	2.605E-22	213	0.881	0.906	P02253.pdb.gz	H12_BOVIN Histone H1.2 OS=Bos taurus OX=9913 GN=H1-2 PE=1 SV=2
5	AFDB:P16401	0.729	0.709	8.354E-22	226	0.872	0.845	P16401.pdb.gz	H15_HUMAN Histone H1.5 OS=Homo sapiens OX=9606 GN=H1-5 PE=1 SV=3
6	AFDB:A5PK20	0.454	0.472	3.024E-19	210	0.822	0.857	A5PK20.pdb.gz	A5PK20_BOVIN H1.12 linker histone, cluster member OS=Bos taurus OX=9913 GN=H1-12 PE=2 SV=1
7	AFDB:Q02539	0.372	0.379	4.547E-16	215	0.703	0.716	Q02539.pdb.gz	H11_HUMAN Histone H1.1 OS=Homo sapiens OX=9606 GN=H1-1 PE=1 SV=3
8	AFDB:P06350	0.429	0.452	2.972E-15	207	0.699	0.739	P06350.pdb.gz	H1_ONCMY Histone H1 OS=Oncorhynchus mykiss OX=8022 PE=1 SV=2
9	AFDB:P43275	0.370	0.380	5.679E-15	213	0.676	0.695	P43275.pdb.gz	H11_MOUSE Histone H1.1 OS=Mus musculus OX=10090 GN=H1-1 PE=1 SV=2
10	AFDB:P06349	0.458	0.480	5.841E-14	208	0.534	0.562	P06349.pdb.gz	H1T_RAT Histone H1t OS=Rattus norvegicus OX=10116 GN=H1-6 PE=1 SV=2
11	PDB:7k5yU	0.330	0.935	7.852E-10	75	0.338	0.987	7k5yU.pdb.gz	Distinct Structures and Dynamics of Chromatosomes with Different Human Linker Histone Isoforms.
12	PDB:6l9zS	0.289	0.696	3.180E-3	84	0.132	0.345	6l9zS.pdb.gz	Engineering nucleosomes for generating diverse chromatin assemblies.
13	PDB:6h1cB	0.278	0.436	9.832E-2	134	0.087	0.142	6h1cB.pdb.gz	Ferric uptake regulator with Mn and Zn form Pseudomonas aeruginosa
14	PDB:2fe3B	0.252	0.371	2.138E-1	143	0.055	0.084	2fe3B.pdb.gz	Crystal structure of the apo-PerR-Zn protein from Bacillus subtilis.
15	PDB:3euhB	0.218	0.157	2.434E-1	321	0.046	0.031	3euhB.pdb.gz
16	PDB:2g9wA	0.265	0.472	3.364E-1	119	0.041	0.076	2g9wA.pdb.gz
17	PDB:4etsB	0.246	0.347	4.961E-1	149	0.046	0.067	4etsB.pdb.gz	Structure and regulon of Campylobacter jejuni ferric uptake regulator Fur define apo-Fur regulation.
18	PDB:4zzlA	0.224	0.323	4.961E-1	146	0.046	0.068	4zzlA.pdb.gz
19	PDB:5oqj2	0.231	0.137	5.293E-1	395	0.068	0.038	5oqj2.pdb.gz	Structures of transcription pre-initiation complex with TFIIH and Mediator.
20	PDB:4a6dA	0.223	0.147	6.427E-1	345	0.050	0.032	4a6dA.pdb.gz	Crystal Structure and Functional Mapping of Human Asmt, the Last Enzyme of the Melatonin Synthesis Pathway.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P10412	4.03e-128	362	219	1.000	1.000	H14_HUMAN Histone H1.4 OS=Homo sapiens OX=9606 GN=H1-4 PE=1 SV=2
2	P16402	6.64e-59	186	221	0.680	0.674	H13_HUMAN Histone H1.3 OS=Homo sapiens OX=9606 GN=H1-3 PE=1 SV=2
3	A5PK20	1.25e-58	185	210	0.785	0.819	A5PK20_BOVIN H1.12 linker histone, cluster member OS=Bos taurus OX=9913 GN=H1-12 PE=2 SV=1
4	P15865	3.29e-54	174	219	0.890	0.890	H14_RAT Histone H1.4 OS=Rattus norvegicus OX=10116 GN=H1-4 PE=1 SV=3
5	P43274	1.69e-52	170	219	0.511	0.511	H14_MOUSE Histone H1.4 OS=Mus musculus OX=10090 GN=H1-4 PE=1 SV=2
6	P16403	3.13e-48	159	213	0.543	0.559	H12_HUMAN Histone H1.2 OS=Homo sapiens OX=9606 GN=H1-2 PE=1 SV=2
7	P02253	4.14e-46	154	213	0.484	0.498	H12_BOVIN Histone H1.2 OS=Bos taurus OX=9913 GN=H1-2 PE=1 SV=2
8	P43276	1.65e-44	150	223	0.411	0.404	H15_MOUSE Histone H1.5 OS=Mus musculus OX=10090 GN=H1-5 PE=1 SV=2
9	P43277	2.85e-44	149	221	0.498	0.493	H13_MOUSE Histone H1.3 OS=Mus musculus OX=10090 GN=H1-3 PE=1 SV=2
10	P16401	1.49e-43	147	226	0.443	0.429	H15_HUMAN Histone H1.5 OS=Homo sapiens OX=9606 GN=H1-5 PE=1 SV=3
11	P22492	2.25e-41	141	207	0.530	0.560	H1T_HUMAN Histone H1t OS=Homo sapiens OX=9606 GN=H1-6 PE=2 SV=4
12	P15864	2.54e-41	141	212	0.374	0.387	H12_MOUSE Histone H1.2 OS=Mus musculus OX=10090 GN=H1-2 PE=1 SV=2
13	Q02539	9.69e-38	132	215	0.384	0.391	H11_HUMAN Histone H1.1 OS=Homo sapiens OX=9606 GN=H1-1 PE=1 SV=3
14	P06350	1.91e-36	129	207	0.279	0.295	H1_ONCMY Histone H1 OS=Oncorhynchus mykiss OX=8022 PE=1 SV=2
15	P43275	3.69e-34	123	213	0.388	0.399	H11_MOUSE Histone H1.1 OS=Mus musculus OX=10090 GN=H1-1 PE=1 SV=2
16	P06349	1.41e-33	121	208	0.365	0.385	H1T_RAT Histone H1t OS=Rattus norvegicus OX=10116 GN=H1-6 PE=1 SV=2
17	Q07133	9.93e-33	119	208	0.534	0.562	H1T_MOUSE Histone H1t OS=Mus musculus OX=10090 GN=H1-6 PE=1 SV=4
18	P02255	6.32e-15	73.6	256	0.269	0.230	H1_DROME Histone H1 OS=Drosophila melanogaster OX=7227 GN=His1 PE=1 SV=1
19	Q08GK9	1.01e-14	71.2	178	0.169	0.208	HSPL_MULSU Protamine-like protein OS=Mullus surmuletus OX=87757 GN=pl PE=1 SV=2
20	P10922	2.12e-13	68.2	194	0.201	0.227	H10_MOUSE Histone H1.0 OS=Mus musculus OX=10090 GN=H1-0 PE=2 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF19110 DUF5797	4.5e+02	11.9	Family of unknown function (DUF5797)
2	PF00538 Linker_histone	4.3e-19	79.9	linker histone H1 and H5 family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000307705

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000336687	0.980	Chromobox protein homolog 3
2	9606.ENSP00000212015	0.968	NAD-dependent protein deacetylase sirtuin-1
3	9606.ENSP00000244537	0.965	Histone cluster 1 H4 family member f
4	9606.ENSP00000367034	0.965	Histone cluster 1 H4 family member c
5	9606.ENSP00000366974	0.955	Histone cluster 1 H4 family member b
6	9606.ENSP00000480826	0.955	Histone cluster 1 H3 family member a
7	9606.ENSP00000484789	0.954	Histone H4
8	9606.ENSP00000484841	0.953	Histone H3.1
9	9606.ENSP00000479461	0.952	Histone cluster 1 H4 family member d
10	9606.ENSP00000347168	0.946	Histone cluster 1 H4 family member j
11	9606.ENSP00000479106	0.946	Histone cluster 1 H4 family member a
12	9606.ENSP00000484658	0.945	Histone cluster 1 H3 family member c
13	9606.ENSP00000480960	0.942	Histone cluster 1 H4 family member l
14	9606.ENSP00000484095	0.941	Histone cluster 1 H3 family member f
15	9606.ENSP00000483842	0.939	Histone H2A type 1-B/E
16	9606.ENSP00000352252	0.938	Histone cluster 1 H3 family member j
17	9606.ENSP00000366956	0.938	Histone cluster 1 H4 family member h
18	9606.ENSP00000443017	0.938	Histone cluster 4, H4
19	9606.ENSP00000462667	0.938	Histone cluster 2 H4 family member a
20	9606.ENSP00000483283	0.938	Histone cluster 1 H3 family member i

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003677	0.999	DNA binding
GO:0005515	0.998	protein binding
GO:0003682	0.966	chromatin binding
GO:0031490	0.961	chromatin DNA binding
GO:0003723	0.915	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.988	cellular process
GO:0050789	0.986	regulation of biological process
GO:0060255	0.983	regulation of macromolecule metabolic process
GO:0016043	0.975	cellular component organization
GO:0050794	0.969	regulation of cellular process
GO:0031323	0.957	regulation of cellular metabolic process
GO:0080090	0.950	regulation of primary metabolic process
GO:0048519	0.949	negative regulation of biological process
GO:0051171	0.947	regulation of nitrogen compound metabolic process
GO:0010468	0.945	regulation of gene expression
GO:0071704	0.905	organic substance metabolic process
GO:0044238	0.895	primary metabolic process
GO:0006325	0.893	chromatin organization
GO:0044237	0.877	cellular metabolic process
GO:0006807	0.865	nitrogen compound metabolic process
GO:0043170	0.845	macromolecule metabolic process
GO:0009892	0.816	negative regulation of metabolic process
GO:0010605	0.814	negative regulation of macromolecule metabolic process
GO:0000122	0.792	negative regulation of transcription by RNA polymerase II
GO:0018205	0.768	peptidyl-lysine modification
GO:0016570	0.740	histone modification
GO:0044260	0.736	cellular macromolecule metabolic process
GO:0043414	0.611	macromolecule methylation
GO:0018022	0.592	peptidyl-lysine methylation
GO:0034968	0.509	histone lysine methylation
GO:0051568	0.501	histone H3-K4 methylation
GO:0018023	0.471	peptidyl-lysine trimethylation
GO:0006338	0.455	chromatin remodeling
GO:0048518	0.440	positive regulation of biological process
GO:0048522	0.395	positive regulation of cellular process
GO:0009893	0.306	positive regulation of metabolic process
GO:0010604	0.304	positive regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0000785	1.000	chromatin
GO:0005634	0.999	nucleus
GO:0031981	0.947	nuclear lumen
GO:0005654	0.944	nucleoplasm
GO:0032991	0.829	protein-containing complex
GO:0000792	0.313	heterochromatin

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]