StarFunc result for job id P10415

User Input

>input (239 residues)
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPA
ASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLH
LTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEY
LNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R2B3	0.886	0.886	1.439E-30	239	1.000	1.000	A0A024R2B3.pdb.gz
2	AFDB:Q00709	0.789	0.809	2.461E-24	233	0.741	0.760	Q00709.pdb.gz	BCL2_CHICK Apoptosis regulator Bcl-2 OS=Gallus gallus OX=9031 GN=BCL2 PE=2 SV=1
3	AFDB:P53563	0.674	0.690	6.610E-14	233	0.397	0.408	P53563.pdb.gz	B2CL1_RAT Bcl-2-like protein 1 OS=Rattus norvegicus OX=10116 GN=Bcl2l1 PE=1 SV=2
4	AFDB:Q564A4	0.658	0.688	8.357E-14	228	0.464	0.487	Q564A4.pdb.gz	Q564A4_DANRE B-cell leukemia/lymphoma 2 OS=Danio rerio OX=7955 GN=bcl2 PE=2 SV=1
5	AFDB:Q90Z98	0.653	0.656	1.052E-12	238	0.368	0.370	Q90Z98.pdb.gz	Q90Z98_DANRE BCL2-like 1 OS=Danio rerio OX=7955 GN=bcl2l PE=1 SV=1
6	AFDB:O35843	0.554	0.564	2.335E-12	235	0.381	0.387	O35843.pdb.gz	O35843_MOUSE Bcl-2-like protein 1 OS=Mus musculus OX=10090 GN=Bcl2l1 PE=1 SV=1
7	AFDB:Q7TS60	0.579	0.629	2.209E-10	219	0.368	0.402	Q7TS60.pdb.gz	Q7TS60_RAT BCL-WEL OS=Rattus norvegicus OX=10116 GN=Bcl2l2 PE=2 SV=1
8	PDB:1lxlA	0.537	0.578	2.982E-8	221	0.406	0.439	1lxlA.pdb.gz
9	PDB:2b48A	0.380	0.617	4.996E-8	143	0.368	0.615	2b48A.pdb.gz
10	PDB:1bxlA	0.545	0.709	5.235E-8	181	0.385	0.508	1bxlA.pdb.gz	Structure of Bcl-xL-Bak peptide complex: recognition between regulators of apoptosis.
11	PDB:1o0lA	0.490	0.610	8.332E-7	188	0.293	0.372	1o0lA.pdb.gz
12	AFDB:O35425	0.537	0.599	7.348E-6	213	0.201	0.225	O35425.pdb.gz	BOK_MOUSE Bcl-2-related ovarian killer protein OS=Mus musculus OX=10090 GN=Bok PE=1 SV=1
13	PDB:4hnjB	0.313	0.559	8.694E-6	130	0.322	0.592	4hnjB.pdb.gz	PUMA binding induces partial unfolding within BCL-xL to disrupt p53 binding and promote apoptosis.
14	AFDB:A0A0D9S330	0.553	0.674	1.121E-5	192	0.172	0.214	A0A0D9S330.pdb.gz	A0A0D9S330_CHLSB BCL2 associated X, apoptosis regulator OS=Chlorocebus sabaeus OX=60711 GN=BAX PE=3 SV=1
15	AFDB:O08734	0.543	0.613	1.417E-5	209	0.188	0.215	O08734.pdb.gz	BAK_MOUSE Bcl-2 homologous antagonist/killer OS=Mus musculus OX=10090 GN=Bak1 PE=1 SV=3
16	PDB:5w62A	0.429	0.626	1.749E-4	156	0.146	0.224	5w62A.pdb.gz
17	PDB:2k7wA	0.445	0.539	3.535E-4	192	0.176	0.219	2k7wA.pdb.gz	BAX activation is initiated at a novel interaction site.
18	PDB:4wmuA	0.430	0.206	8.993E-3	516	0.117	0.054	4wmuA.pdb.gz	A Maltose-Binding Protein Fusion Construct Yields a Robust Crystallography Platform for MCL1.
19	PDB:5ktgA	0.260	0.206	7.390E-1	308	0.105	0.081	5ktgA.pdb.gz
20	PDB:7bp3A	0.150	0.109	1.425	394	0.096	0.058	7bp3A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P10415	1.83e-179	493	239	1.000	1.000	BCL2_HUMAN Apoptosis regulator Bcl-2 OS=Homo sapiens OX=9606 GN=BCL2 PE=1 SV=2
2	P10417	2.63e-157	437	236	0.904	0.915	BCL2_MOUSE Apoptosis regulator Bcl-2 OS=Mus musculus OX=10090 GN=Bcl2 PE=1 SV=3
3	P49950	9.01e-154	428	236	0.887	0.898	BCL2_RAT Apoptosis regulator Bcl-2 OS=Rattus norvegicus OX=10116 GN=Bcl2 PE=1 SV=2
4	Q00709	1.29e-118	339	233	0.736	0.755	BCL2_CHICK Apoptosis regulator Bcl-2 OS=Gallus gallus OX=9031 GN=BCL2 PE=2 SV=1
5	O02718	1.88e-116	333	229	0.887	0.926	BCL2_BOVIN Apoptosis regulator Bcl-2 OS=Bos taurus OX=9913 GN=BCL2 PE=2 SV=1
6	Q564A4	1.50e-63	199	228	0.473	0.496	Q564A4_DANRE B-cell leukemia/lymphoma 2 OS=Danio rerio OX=7955 GN=bcl2 PE=2 SV=1
7	Q07817	7.64e-57	182	233	0.414	0.425	B2CL1_HUMAN Bcl-2-like protein 1 OS=Homo sapiens OX=9606 GN=BCL2L1 PE=1 SV=1
8	P53563	2.01e-54	176	233	0.393	0.403	B2CL1_RAT Bcl-2-like protein 1 OS=Rattus norvegicus OX=10116 GN=Bcl2l1 PE=1 SV=2
9	Q64373	2.01e-54	176	233	0.397	0.408	B2CL1_MOUSE Bcl-2-like protein 1 OS=Mus musculus OX=10090 GN=Bcl2l1 PE=1 SV=1
10	Q90Z98	4.30e-49	163	238	0.397	0.399	Q90Z98_DANRE BCL2-like 1 OS=Danio rerio OX=7955 GN=bcl2l PE=1 SV=1
11	O35843	2.98e-48	160	235	0.372	0.379	O35843_MOUSE Bcl-2-like protein 1 OS=Mus musculus OX=10090 GN=Bcl2l1 PE=1 SV=1
12	Q92843	1.23e-46	155	193	0.310	0.383	B2CL2_HUMAN Bcl-2-like protein 2 OS=Homo sapiens OX=9606 GN=BCL2L2 PE=1 SV=2
13	O88996	3.06e-46	154	193	0.310	0.383	O88996_RAT BCL-W OS=Rattus norvegicus OX=10116 GN=Bcl2l2 PE=2 SV=1
14	P70345	3.17e-46	154	193	0.310	0.383	B2CL2_MOUSE Bcl-2-like protein 2 OS=Mus musculus OX=10090 GN=Bcl2l2 PE=1 SV=1
15	Q7TS60	1.19e-45	153	219	0.310	0.338	Q7TS60_RAT BCL-WEL OS=Rattus norvegicus OX=10116 GN=Bcl2l2 PE=2 SV=1
16	Q16611	9.17e-13	67.4	211	0.176	0.199	BAK_HUMAN Bcl-2 homologous antagonist/killer OS=Homo sapiens OX=9606 GN=BAK1 PE=1 SV=1
17	Q63690	1.53e-12	66.2	192	0.167	0.208	BAX_RAT Apoptosis regulator BAX OS=Rattus norvegicus OX=10116 GN=Bax PE=1 SV=2
18	A0A0S2Z3D2	1.85e-12	65.1	151	0.192	0.305	A0A0S2Z3D2_HUMAN Bcl-2-like protein 1 OS=Homo sapiens OX=9606 GN=BCL2L1 PE=1 SV=1
19	Q07812	2.05e-12	65.9	192	0.172	0.214	BAX_HUMAN Apoptosis regulator BAX OS=Homo sapiens OX=9606 GN=BAX PE=1 SV=1
20	Q9Z1P3	4.44e-12	66.6	330	0.163	0.118	MCL1_RAT Induced myeloid leukemia cell differentiation protein Mcl-1 homolog OS=Rattus norvegicus OX=10116 GN=Mcl1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00452 Bcl-2	5.4e-25	99.3	Apoptosis regulator proteins, Bcl-2 family
2	PF15286 Bcl-2_3	14	17.8	Apoptosis regulator M11, B cell 2 leukaemia/lymphoma like
3	PF02180 BH4	2.3e-10	51.4	Bcl-2 homology region 4

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000381185

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000355231	0.999	Beclin-1
2	9606.ENSP00000293288	0.998	Apoptosis regulator BAX
3	9606.ENSP00000269305	0.995	Cellular tumor antigen p53
4	9606.ENSP00000378040	0.995	Bcl2-associated agonist of cell death
5	9606.ENSP00000376943	0.992	Bcl-2-like protein 11
6	9606.ENSP00000216115	0.990	Bcl-2-interacting killer
7	9606.ENSP00000404503	0.990	Bcl-2-binding component 3
8	9606.ENSP00000318822	0.989	BH3-interacting domain death agonist
9	9606.ENSP00000302564	0.987	Bcl-2-like protein 1
10	9606.ENSP00000476767	0.986	Peptidyl-prolyl cis-trans isomerase FKBP8
11	9606.ENSP00000440864	0.980	Nuclear receptor subfamily 4 group A member 1
12	9606.ENSP00000363591	0.979	Bcl-2 homologous antagonist/killer
13	9606.ENSP00000326119	0.976	Phorbol-12-myristate-13-acetate-induced protein 1
14	9606.ENSP00000448165	0.973	Apoptotic protease-activating factor 1
15	9606.ENSP00000357625	0.970	BCL2/adenovirus E1B 19 kDa protein-interacting protein 3
16	9606.ENSP00000307786	0.967	Cytochrome c
17	9606.ENSP00000358022	0.958	Induced myeloid leukemia cell differentiation protein Mcl-1
18	9606.ENSP00000378974	0.957	Mitogen-activated protein kinase 8
19	9606.ENSP00000215832	0.954	Mitogen-activated protein kinase 1
20	9606.ENSP00000451828	0.944	RAC-alpha serine/threonine-protein kinase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019904	1.000	protein domain specific binding
GO:0019899	0.997	enzyme binding
GO:0051400	0.992	BH domain binding
GO:0042802	0.911	identical protein binding
GO:0098772	0.547	molecular function regulator activity
GO:0030234	0.468	enzyme regulator activity
GO:0140678	0.307	molecular function inhibitor activity
GO:0044877	0.301	protein-containing complex binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.978	regulation of cellular process
GO:0051716	0.977	cellular response to stimulus
GO:0048518	0.975	positive regulation of biological process
GO:0048522	0.971	positive regulation of cellular process
GO:0048519	0.970	negative regulation of biological process
GO:0006915	0.967	apoptotic process
GO:0007165	0.966	signal transduction
GO:0006950	0.965	response to stress
GO:0048583	0.964	regulation of response to stimulus
GO:0048523	0.959	negative regulation of cellular process
GO:0042221	0.957	response to chemical
GO:0023051	0.954	regulation of signaling
GO:0010646	0.952	regulation of cell communication
GO:0010033	0.949	response to organic substance
GO:0097190	0.947	apoptotic signaling pathway
GO:0009966	0.943	regulation of signal transduction
GO:0032501	0.942	multicellular organismal process
GO:0033554	0.940	cellular response to stress
GO:0032502	0.935	developmental process
GO:0048856	0.931	anatomical structure development
GO:0019222	0.925	regulation of metabolic process
GO:0042127	0.925	regulation of cell population proliferation
GO:0060548	0.924	negative regulation of cell death
GO:2001233	0.915	regulation of apoptotic signaling pathway
GO:0065009	0.913	regulation of molecular function
GO:0042592	0.912	homeostatic process
GO:0065008	0.909	regulation of biological quality
GO:0048585	0.909	negative regulation of response to stimulus
GO:0009892	0.897	negative regulation of metabolic process
GO:0048869	0.888	cellular developmental process
GO:0043066	0.888	negative regulation of apoptotic process
GO:0008284	0.884	positive regulation of cell population proliferation
GO:0030154	0.882	cell differentiation
GO:0097193	0.882	intrinsic apoptotic signaling pathway
GO:0048513	0.880	animal organ development
GO:0051128	0.880	regulation of cellular component organization
GO:0031323	0.878	regulation of cellular metabolic process
GO:0007275	0.875	multicellular organism development
GO:0023057	0.875	negative regulation of signaling
GO:0010648	0.875	negative regulation of cell communication
GO:0048731	0.872	system development
GO:0010506	0.869	regulation of autophagy
GO:0009968	0.854	negative regulation of signal transduction
GO:0080135	0.832	regulation of cellular response to stress
GO:0097191	0.826	extrinsic apoptotic signaling pathway
GO:0002376	0.825	immune system process
GO:0051881	0.825	regulation of mitochondrial membrane potential
GO:0060255	0.821	regulation of macromolecule metabolic process
GO:0009605	0.812	response to external stimulus
GO:1901214	0.804	regulation of neuron death
GO:0009719	0.803	response to endogenous stimulus
GO:0007005	0.798	mitochondrion organization
GO:0045321	0.793	leukocyte activation
GO:0043523	0.787	regulation of neuron apoptotic process
GO:2001242	0.786	regulation of intrinsic apoptotic signaling pathway
GO:0008283	0.785	cell population proliferation
GO:0080090	0.776	regulation of primary metabolic process
GO:0008406	0.765	gonad development
GO:0007006	0.760	mitochondrial membrane organization
GO:0051171	0.758	regulation of nitrogen compound metabolic process
GO:0048584	0.751	positive regulation of response to stimulus
GO:0071704	0.749	organic substance metabolic process
GO:0009893	0.748	positive regulation of metabolic process
GO:0006839	0.742	mitochondrial transport
GO:0051049	0.734	regulation of transport
GO:0043524	0.732	negative regulation of neuron apoptotic process
GO:0050793	0.731	regulation of developmental process
GO:0046649	0.728	lymphocyte activation
GO:2001234	0.727	negative regulation of apoptotic signaling pathway
GO:0010243	0.724	response to organonitrogen compound
GO:0009888	0.721	tissue development
GO:0051172	0.720	negative regulation of nitrogen compound metabolic process
GO:0046902	0.708	regulation of mitochondrial membrane permeability
GO:0019725	0.701	cellular homeostasis
GO:0070997	0.700	neuron death
GO:0071310	0.692	cellular response to organic substance
GO:0051246	0.681	regulation of protein metabolic process
GO:0009628	0.672	response to abiotic stimulus
GO:0055082	0.671	intracellular chemical homeostasis
GO:0006974	0.670	cellular response to DNA damage stimulus
GO:0051402	0.667	neuron apoptotic process
GO:0010605	0.647	negative regulation of macromolecule metabolic process
GO:0044419	0.641	biological process involved in interspecies interaction between organisms
GO:0042113	0.639	B cell activation
GO:0060429	0.638	epithelium development
GO:1901700	0.634	response to oxygen-containing compound
GO:0051239	0.622	regulation of multicellular organismal process
GO:0044238	0.602	primary metabolic process
GO:0042110	0.576	T cell activation
GO:0006807	0.562	nitrogen compound metabolic process
GO:0050801	0.561	monoatomic ion homeostasis
GO:0010604	0.551	positive regulation of macromolecule metabolic process
GO:0001654	0.529	eye development
GO:0048468	0.526	cell development
GO:0030097	0.522	hemopoiesis
GO:0044237	0.512	cellular metabolic process
GO:0014070	0.505	response to organic cyclic compound
GO:1902532	0.505	negative regulation of intracellular signal transduction
GO:0051173	0.495	positive regulation of nitrogen compound metabolic process
GO:0009653	0.490	anatomical structure morphogenesis
GO:0043170	0.483	macromolecule metabolic process
GO:0034097	0.469	response to cytokine
GO:1901564	0.463	organonitrogen compound metabolic process
GO:0010468	0.457	regulation of gene expression
GO:0060322	0.456	head development
GO:0007399	0.456	nervous system development
GO:0007420	0.452	brain development
GO:0019538	0.448	protein metabolic process
GO:0048871	0.436	multicellular organismal-level homeostasis
GO:0008585	0.421	female gonad development
GO:0031325	0.413	positive regulation of cellular metabolic process
GO:0043068	0.404	positive regulation of programmed cell death
GO:0031324	0.391	negative regulation of cellular metabolic process
GO:0043065	0.387	positive regulation of apoptotic process
GO:0010035	0.352	response to inorganic substance
GO:0002088	0.336	lens development in camera-type eye
GO:2001243	0.335	negative regulation of intrinsic apoptotic signaling pathway
GO:0050790	0.322	regulation of catalytic activity
GO:0009889	0.306	regulation of biosynthetic process
GO:0010556	0.300	regulation of macromolecule biosynthetic process
GO:0031326	0.300	regulation of cellular biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	0.999	endomembrane system
GO:0031090	0.999	organelle membrane
GO:0031967	0.999	organelle envelope
GO:0005654	0.998	nucleoplasm
GO:0005829	0.967	cytosol
GO:0032991	0.932	protein-containing complex
GO:0005739	0.917	mitochondrion
GO:0005635	0.859	nuclear envelope
GO:0031966	0.553	mitochondrial membrane
GO:0031965	0.380	nuclear membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]