StarFunc result for job id P10451

User Input

>input (314 residues)
MRIAVICFCLLGITCAIPVKQADSGSSEEKQLYNKYPDAVATWLNPDPSQKQNLLAPQNA
VSSEETNDFKQETLPSKSNESHDHMDDMDDEDDDDHVDSQDSIDSNDSDDVDDTDDSHQS
DESHHSDESDELVTDFPTDLPATEVFTPVVPTVDTYDGRGDSVVYGLRSKSKKFRRPDIQ
YPDATDEDITSHMESEELNGAYKAIPVAQDLNAPSDWDSRGKDSYETSQLDDQSAETHSH
KQSRLYKRKANDESNEHSDVIDSQELSKVSREFHSHEFHSHEDMLVVDPKSKEEDKHLKF
RISHELDSASSEVN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024RDE2	0.106	0.106	1.966E-41	314	1.000	1.000	A0A024RDE2.pdb.gz
2	AFDB:F2YQ21	0.084	0.090	5.166E-37	292	0.930	1.000	F2YQ21.pdb.gz	F2YQ21_HUMAN Osteopontin-D OS=Homo sapiens OX=9606 PE=2 SV=1
3	AFDB:P08721	0.095	0.094	1.095E-24	317	0.650	0.644	P08721.pdb.gz	OSTP_RAT Osteopontin OS=Rattus norvegicus OX=10116 GN=Spp1 PE=1 SV=2
4	AFDB:P21815	0.085	0.084	4.188E-1	317	0.143	0.142	P21815.pdb.gz	SIAL_HUMAN Bone sialoprotein 2 OS=Homo sapiens OX=9606 GN=IBSP PE=1 SV=4
5	AFDB:O74779	0.099	0.069	1.087	517	0.140	0.085	O74779.pdb.gz	MU164_SCHPO Microtubule-associated protein mug164 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug164 PE=1 SV=4
6	AFDB:Q5H9M0	0.104	0.058	1.177	696	0.153	0.069	Q5H9M0.pdb.gz	PWP3B_HUMAN PWWP domain-containing DNA repair factor 3B OS=Homo sapiens OX=9606 GN=PWWP3B PE=2 SV=1
7	AFDB:P97481	0.091	0.043	1.380	874	0.156	0.056	P97481.pdb.gz	EPAS1_MOUSE Endothelial PAS domain-containing protein 1 OS=Mus musculus OX=10090 GN=Epas1 PE=1 SV=2
8	AFDB:Q8IJW3	0.076	0.016	1.752	2379	0.108	0.014	Q8IJW3.pdb.gz	Q8IJW3_PLAF7 Histone deacetylase 2 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1008000 PE=3 SV=1
9	AFDB:Q9UQB3	0.085	0.028	1.897	1225	0.172	0.044	Q9UQB3.pdb.gz	CTND2_HUMAN Catenin delta-2 OS=Homo sapiens OX=9606 GN=CTNND2 PE=1 SV=3
10	AFDB:Q9VG65	0.103	0.088	2.054	387	0.127	0.103	Q9VG65.pdb.gz	Q9VG65_DROME GH03227p OS=Drosophila melanogaster OX=7227 GN=vrs PE=2 SV=1
11	PDB:6hivAU	0.078	0.114	9.235	175	0.032	0.057	6hivAU.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
12	PDB:7wi3B	0.074	0.081	9.235	275	0.025	0.029	7wi3B.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F2YQ21	0.0	586	292	0.930	1.000	F2YQ21_HUMAN Osteopontin-D OS=Homo sapiens OX=9606 PE=2 SV=1
2	P10451	0.0	637	314	1.000	1.000	OSTP_HUMAN Osteopontin OS=Homo sapiens OX=9606 GN=SPP1 PE=1 SV=1
3	P31096	1.35e-112	329	278	0.621	0.701	OSTP_BOVIN Osteopontin OS=Bos taurus OX=9913 GN=SPP1 PE=1 SV=2
4	P08721	8.17e-111	326	317	0.634	0.628	OSTP_RAT Osteopontin OS=Rattus norvegicus OX=10116 GN=Spp1 PE=1 SV=2
5	P10923	1.72e-108	319	294	0.637	0.680	OSTP_MOUSE Osteopontin OS=Mus musculus OX=10090 GN=Spp1 PE=1 SV=1
6	Q9I832	6.96e-07	52.0	264	0.207	0.246	Q9I832_COTJA Osteopontin OS=Coturnix japonica OX=93934 GN=OPN PE=2 SV=1
7	O14234	0.061	37.7	1854	0.076	0.013	CCH1_SCHPO Calcium-channel protein cch1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cch1 PE=3 SV=1
8	Q32MD9	0.82	33.9	1250	0.073	0.018	CDON_MOUSE Cell adhesion molecule-related/down-regulated by oncogenes OS=Mus musculus OX=10090 GN=Cdon PE=1 SV=2
9	Q13316	0.87	33.9	513	0.032	0.019	DMP1_HUMAN Dentin matrix acidic phosphoprotein 1 OS=Homo sapiens OX=9606 GN=DMP1 PE=1 SV=2
10	O55188	6.7	30.8	503	0.038	0.024	DMP1_MOUSE Dentin matrix acidic phosphoprotein 1 OS=Mus musculus OX=10090 GN=Dmp1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00865 Osteopontin	1.5e-152	518.7	Osteopontin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000378517

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000261023	0.999	Integrin alpha-V
2	9606.ENSP00000398632	0.999	CD44 antigen
3	9606.ENSP00000379350	0.997	Integrin beta-1
4	9606.ENSP00000299855	0.984	Stromelysin-1
5	9606.ENSP00000352603	0.984	AP-4 complex subunit mu-1
6	9606.ENSP00000346839	0.983	Fibronectin type III domain containing
7	9606.ENSP00000260227	0.968	Matrilysin
8	9606.ENSP00000264741	0.953	Integrin alpha-9
9	9606.ENSP00000452786	0.945	Integrin beta-3
10	9606.ENSP00000400175	0.938	Transforming protein RhoA
11	9606.ENSP00000380227	0.933	Integrin alpha-4
12	9606.ENSP00000311469	0.932	Glutathione S-transferase Mu 1
13	9606.ENSP00000380638	0.923	Protein-tyrosine kinase 2-beta
14	9606.ENSP00000383118	0.923	Cell division control protein 42 homolog
15	9606.ENSP00000382800	0.921	Runt-related transcription factor 3
16	9606.ENSP00000364907	0.920	Tyrosine-protein kinase SYK
17	9606.ENSP00000367316	0.919	Integrin alpha-8
18	9606.ENSP00000357255	0.918	Osteocalcin
19	9606.ENSP00000391669	0.917	Breast cancer anti-estrogen resistance protein 1
20	9606.ENSP00000226284	0.916	Bone sialoprotein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005102	0.942	signaling receptor binding
GO:0036094	0.833	small molecule binding
GO:0005178	0.635	integrin binding
GO:0043167	0.551	ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.992	regulation of cellular process
GO:0050896	0.991	response to stimulus
GO:0032501	0.985	multicellular organismal process
GO:0048856	0.985	anatomical structure development
GO:0051239	0.983	regulation of multicellular organismal process
GO:0009987	0.982	cellular process
GO:0019222	0.977	regulation of metabolic process
GO:0023056	0.966	positive regulation of signaling
GO:0070887	0.965	cellular response to chemical stimulus
GO:0010647	0.965	positive regulation of cell communication
GO:0071704	0.957	organic substance metabolic process
GO:0032879	0.956	regulation of localization
GO:0009605	0.954	response to external stimulus
GO:0009889	0.950	regulation of biosynthetic process
GO:0044238	0.946	primary metabolic process
GO:0060255	0.941	regulation of macromolecule metabolic process
GO:0007275	0.940	multicellular organism development
GO:0009893	0.925	positive regulation of metabolic process
GO:0080090	0.917	regulation of primary metabolic process
GO:0010033	0.907	response to organic substance
GO:1905952	0.890	regulation of lipid localization
GO:0048513	0.886	animal organ development
GO:0051049	0.881	regulation of transport
GO:0031323	0.874	regulation of cellular metabolic process
GO:0051240	0.851	positive regulation of multicellular organismal process
GO:0032368	0.843	regulation of lipid transport
GO:0051050	0.840	positive regulation of transport
GO:0051171	0.830	regulation of nitrogen compound metabolic process
GO:0048583	0.827	regulation of response to stimulus
GO:0031326	0.824	regulation of cellular biosynthetic process
GO:1901700	0.822	response to oxygen-containing compound
GO:0010817	0.814	regulation of hormone levels
GO:1905954	0.807	positive regulation of lipid localization
GO:0048519	0.784	negative regulation of biological process
GO:0009719	0.755	response to endogenous stimulus
GO:0044060	0.752	regulation of endocrine process
GO:0022414	0.745	reproductive process
GO:0007565	0.742	female pregnancy
GO:0046883	0.734	regulation of hormone secretion
GO:0031325	0.722	positive regulation of cellular metabolic process
GO:0032370	0.719	positive regulation of lipid transport
GO:1903532	0.708	positive regulation of secretion by cell
GO:0010604	0.702	positive regulation of macromolecule metabolic process
GO:0008209	0.697	androgen metabolic process
GO:1901654	0.693	response to ketone
GO:0010468	0.678	regulation of gene expression
GO:0048523	0.671	negative regulation of cellular process
GO:0060135	0.662	maternal process involved in female pregnancy
GO:2000831	0.656	regulation of steroid hormone secretion
GO:0071310	0.647	cellular response to organic substance
GO:0019219	0.641	regulation of nucleobase-containing compound metabolic process
GO:0010556	0.624	regulation of macromolecule biosynthetic process
GO:2000833	0.616	positive regulation of steroid hormone secretion
GO:0050793	0.612	regulation of developmental process
GO:0051173	0.605	positive regulation of nitrogen compound metabolic process
GO:0001890	0.562	placenta development
GO:0006950	0.546	response to stress
GO:0033993	0.499	response to lipid
GO:0014070	0.499	response to organic cyclic compound
GO:0051252	0.458	regulation of RNA metabolic process
GO:0007155	0.453	cell adhesion
GO:0031328	0.431	positive regulation of cellular biosynthetic process
GO:0010557	0.430	positive regulation of macromolecule biosynthetic process
GO:0006355	0.426	regulation of DNA-templated transcription
GO:0051254	0.425	positive regulation of RNA metabolic process
GO:0009888	0.424	tissue development
GO:0045893	0.424	positive regulation of DNA-templated transcription
GO:0007154	0.394	cell communication
GO:0009056	0.353	catabolic process
GO:0045595	0.344	regulation of cell differentiation
GO:0030154	0.343	cell differentiation
GO:0001893	0.342	maternal placenta development
GO:2000026	0.340	regulation of multicellular organismal development
GO:0009966	0.339	regulation of signal transduction
GO:0048731	0.332	system development
GO:1901701	0.329	cellular response to oxygen-containing compound
GO:0033280	0.326	response to vitamin D
GO:0007566	0.325	embryo implantation
GO:0006706	0.323	steroid catabolic process
GO:0033574	0.322	response to testosterone
GO:0051128	0.310	regulation of cellular component organization
GO:0044237	0.308	cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	1.000	endomembrane system
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0005794	0.990	Golgi apparatus
GO:0005576	0.884	extracellular region
GO:0071944	0.529	cell periphery
GO:0016020	0.495	membrane
GO:0005615	0.459	extracellular space

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]