StarFunc result for job id P10515

User Input

>input (647 residues)
MWRVCARRAQNVAPWAGLEARWTALQEVPGTPRVTSRSGPAPARRNSVTTGYGGVRALCG
WTPSSGATPRNRLLLQLLGSPGRRYYSLPPHQKVPLPSLSPTMQAGTIARWEKKEGDKIN
EGDLIAEVETDKATVGFESLEECYMAKILVAEGTRDVPIGAIICITVGKPEDIEAFKNYT
LDSSAAPTPQAAPAPTPAATASPPTPSAQAPGSSYPPHMQVLLPALSPTMTMGTVQRWEK
KVGEKLSEGDLLAEIETDKATIGFEVQEEGYLAKILVPEGTRDVPLGTPLCIIVEKEADI
SAFADYRPTEVTDLKPQVPPPTPPPVAAVPPTPQPLAPTPSAPCPATPAGPKGRVFVSPL
AKKLAVEKGIDLTQVKGTGPDGRITKKDIDSFVPSKVAPAPAAVVPPTGPGMAPVPTGVF
TDIPISNIRRVIAQRLMQSKQTIPHYYLSIDVNMGEVLLVRKELNKILEGRSKISVNDFI
IKASALACLKVPEANSSWMDTVIRQNHVVDVSVAVSTPAGLITPIVFNAHIKGVETIAND
VVSLATKAREGKLQPHEFQGGTFTISNLGMFGIKNFSAIINPPQACILAIGASEDKLVPA
DNEKGFDVASMMSVTLSCDHRVVDGAVGAQWLAEFRKYLEKPITMLL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P10515	1.000	1.000	0.000	647	1.000	1.000	P10515.pdb.gz	ODP2_HUMAN Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial OS=Homo sapiens OX=9606 GN=DLAT PE=1 SV=3
2	AFDB:Q8BMF4	0.684	0.689	0.000	642	0.855	0.861	Q8BMF4.pdb.gz	ODP2_MOUSE Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial OS=Mus musculus OX=10090 GN=Dlat PE=1 SV=2
3	AFDB:Q804C3	0.526	0.522	1.371E-95	652	0.722	0.716	Q804C3.pdb.gz	Q804C3_DANRE Acetyltransferase component of pyruvate dehydrogenase complex OS=Danio rerio OX=7955 GN=wu:fc21f08 PE=1 SV=1
4	AFDB:E9PEJ4	0.356	0.424	1.853E-93	542	0.838	1.000	E9PEJ4.pdb.gz	E9PEJ4_HUMAN Acetyltransferase component of pyruvate dehydrogenase complex OS=Homo sapiens OX=9606 GN=DLAT PE=1 SV=1
5	AFDB:H0YDD4	0.426	0.524	1.238E-89	520	0.801	0.996	H0YDD4.pdb.gz	H0YDD4_HUMAN Acetyltransferase component of pyruvate dehydrogenase complex OS=Homo sapiens OX=9606 GN=DLAT PE=1 SV=2
6	AFDB:Q19749	0.475	0.599	4.348E-61	507	0.417	0.533	Q19749.pdb.gz	ODP2_CAEEL Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=dlat-1 PE=1 SV=1
7	AFDB:Q9VM14	0.360	0.454	1.340E-59	512	0.405	0.512	Q9VM14.pdb.gz	Q9VM14_DROME dihydrolipoyllysine-residue acetyltransferase OS=Drosophila melanogaster OX=7227 GN=muc PE=1 SV=1
8	AFDB:O59816	0.482	0.636	3.894E-58	483	0.321	0.431	O59816.pdb.gz	ODP2_SCHPO Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=lat1 PE=3 SV=1
9	AFDB:M9PCU4	0.464	0.602	6.647E-57	489	0.357	0.472	M9PCU4.pdb.gz	M9PCU4_DROME dihydrolipoyllysine-residue acetyltransferase OS=Drosophila melanogaster OX=7227 GN=muc PE=1 SV=1
10	AFDB:Q8RWN9	0.358	0.428	1.273E-56	539	0.365	0.438	Q8RWN9.pdb.gz	ODP22_ARATH Dihydrolipoyllysine-residue acetyltransferase component 2 of pyruvate dehydrogenase complex, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At3g13930 PE=1 SV=2
11	PDB:6h55A	0.353	0.962	1.664E-39	233	0.360	1.000	6h55A.pdb.gz
12	PDB:6h60A	0.341	0.925	2.592E-28	233	0.176	0.489	6h60A.pdb.gz
13	PDB:7b9kA	0.349	0.687	1.278E-27	320	0.145	0.294	7b9kA.pdb.gz
14	PDB:5ja2A	0.166	0.097	8.959E-6	1238	0.049	0.026	5ja2A.pdb.gz	Structures of a Nonribosomal Peptide Synthetase Module Bound to MbtH-like Proteins Support a Highly Dynamic Domain Architecture.
15	PDB:4eywB	0.194	0.198	5.939E-5	634	0.051	0.052	4eywB.pdb.gz	Isothermal titration calorimetry with micelles: Thermodynamics of inhibitor binding to carnitine palmitoyltransferase 2 membrane protein.
16	PDB:5kjtA	0.179	0.252	1.281E-4	431	0.039	0.058	5kjtA.pdb.gz	Dynamic Conformational States Dictate Selectivity toward the Native Substrate in a Substrate-Permissive Acyltransferase.
17	PDB:3n6rA	0.104	0.113	1.441E-4	591	0.049	0.054	3n6rA.pdb.gz	Crystal structure of the alpha(6)beta(6) holoenzyme of propionyl-coenzyme A carboxylase.
18	PDB:3n6rG	0.103	0.104	1.937E-4	646	0.049	0.050	3n6rG.pdb.gz	Crystal structure of the alpha(6)beta(6) holoenzyme of propionyl-coenzyme A carboxylase.
19	PDB:6lpwB	0.183	0.257	3.937E-4	436	0.036	0.053	6lpwB.pdb.gz	Structural and Biochemical Insights Into Two BAHD Acyltransferases ( At SHT and At SDT) Involved in Phenolamide Biosynthesis.
20	PDB:2h3pA	0.205	0.220	9.007E-4	599	0.040	0.043	2h3pA.pdb.gz	Crystal structures of murine carnitine acetyltransferase in ternary complexes with its substrates

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E9PEJ4	0.0	738	542	0.601	0.718	E9PEJ4_HUMAN Acetyltransferase component of pyruvate dehydrogenase complex OS=Homo sapiens OX=9606 GN=DLAT PE=1 SV=1
2	H0YDD4	0.0	789	520	0.654	0.813	H0YDD4_HUMAN Acetyltransferase component of pyruvate dehydrogenase complex OS=Homo sapiens OX=9606 GN=DLAT PE=1 SV=2
3	P08461	0.0	996	632	0.825	0.845	ODP2_RAT Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial OS=Rattus norvegicus OX=10116 GN=Dlat PE=1 SV=3
4	P10515	0.0	1310	647	1.000	1.000	ODP2_HUMAN Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial OS=Homo sapiens OX=9606 GN=DLAT PE=1 SV=3
5	Q804C3	0.0	822	652	0.679	0.673	Q804C3_DANRE Acetyltransferase component of pyruvate dehydrogenase complex OS=Danio rerio OX=7955 GN=wu:fc21f08 PE=1 SV=1
6	Q86YI5	0.0	1310	647	1.000	1.000	Q86YI5_HUMAN Acetyltransferase component of pyruvate dehydrogenase complex OS=Homo sapiens OX=9606 GN=DLAT PE=2 SV=1
7	Q8BMF4	0.0	1021	642	0.855	0.861	ODP2_MOUSE Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial OS=Mus musculus OX=10090 GN=Dlat PE=1 SV=2
8	Q19749	3.80e-166	486	507	0.397	0.507	ODP2_CAEEL Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=dlat-1 PE=1 SV=1
9	Q5M729	1.82e-138	417	539	0.334	0.401	ODP23_ARATH Dihydrolipoyllysine-residue acetyltransferase component 3 of pyruvate dehydrogenase complex, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At1g54220 PE=1 SV=1
10	O59816	2.93e-137	412	483	0.321	0.431	ODP2_SCHPO Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=lat1 PE=3 SV=1
11	Q9VM14	4.16e-132	399	512	0.346	0.438	Q9VM14_DROME dihydrolipoyllysine-residue acetyltransferase OS=Drosophila melanogaster OX=7227 GN=muc PE=1 SV=1
12	Q8RWN9	1.73e-129	394	539	0.320	0.384	ODP22_ARATH Dihydrolipoyllysine-residue acetyltransferase component 2 of pyruvate dehydrogenase complex, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At3g13930 PE=1 SV=2
13	Q0WQF7	6.74e-127	390	637	0.357	0.363	ODP21_ARATH Dihydrolipoyllysine-residue acetyltransferase component 1 of pyruvate dehydrogenase complex, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=LTA3 PE=1 SV=2
14	M9PCG1	1.09e-126	385	496	0.337	0.440	M9PCG1_DROME Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex OS=Drosophila melanogaster OX=7227 GN=muc PE=1 SV=1
15	F4J5T2	2.53e-126	391	713	0.366	0.332	F4J5T2_ARATH Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex OS=Arabidopsis thaliana OX=3702 GN=LTA3 PE=1 SV=1
16	Q7KTK9	6.62e-125	378	421	0.331	0.508	Q7KTK9_DROME dihydrolipoyllysine-residue acetyltransferase OS=Drosophila melanogaster OX=7227 GN=muc PE=1 SV=1
17	Q5AYC2	9.16e-119	364	488	0.314	0.416	Q5AYC2_EMENI Acetyltransferase component of pyruvate dehydrogenase complex OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_06708 PE=3 SV=1
18	G8BAA7	3.41e-117	360	483	0.317	0.424	G8BAA7_CANPC Acetyltransferase component of pyruvate dehydrogenase complex OS=Candida parapsilosis (strain CDC 317 / ATCC MYA-4646) OX=578454 GN=LAT1 PE=3 SV=1
19	P12695	1.11e-115	356	482	0.312	0.419	ODP2_YEAST Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=LAT1 PE=1 SV=1
20	Q38AK7	1.01e-97	308	451	0.297	0.426	Q38AK7_TRYB2 Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.3080 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00198 2-oxoacid_dh	3.6e-76	267.2	2-oxoacid dehydrogenases acyltransferase (catalytic domain)
2	PF00364 Biotin_lipoyl	1.8e-28	109.5	Biotin-requiring enzyme
3	PF13533 Biotin_lipoyl_2	0.013	26.6	Biotin-lipoyl like
4	PF09891 DUF2118	3.7e+02	12.5	Uncharacterized protein conserved in archaea (DUF2118)
5	PF02817 E3_binding	2.9e-12	58.0	e3 binding domain
6	PF13437 HlyD_3	92	15.1	HlyD family secretion protein
7	PF02749 QRPTase_N	4.5e+02	12.3	Quinolinate phosphoribosyl transferase, N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000280346

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000205402	0.999	Dihydrolipoyl dehydrogenase, mitochondrial
2	9606.ENSP00000307241	0.999	Pyruvate dehydrogenase E1 component subunit beta, mitochondrial
3	9606.ENSP00000369134	0.999	Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial
4	9606.ENSP00000295266	0.998	Pyruvate dehydrogenase E1 component subunit alpha, testis-specific form, mitochondrial
5	9606.ENSP00000387536	0.998	[Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 3, mitochondrial
6	9606.ENSP00000342056	0.994	Citrate synthase, mitochondrial
7	9606.ENSP00000222673	0.992	2-oxoglutarate dehydrogenase, mitochondrial
8	9606.ENSP00000227868	0.991	Pyruvate dehydrogenase protein X component, mitochondrial
9	9606.ENSP00000335304	0.988	Dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex)
10	9606.ENSP00000319531	0.985	Glycine cleavage system H protein, mitochondrial
11	9606.ENSP00000377446	0.985	Succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial
12	9606.ENSP00000377115	0.983	Lipoyltransferase 1, mitochondrial
13	9606.ENSP00000420927	0.982	[Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 2, mitochondrial
14	9606.ENSP00000376352	0.977	[Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 1, mitochondrial
15	9606.ENSP00000253792	0.975	ATP-citrate synthase
16	9606.ENSP00000309548	0.975	[Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 2, mitochondrial
17	9606.ENSP00000367923	0.974	Succinate--CoA ligase [ADP-forming] subunit beta, mitochondrial
18	9606.ENSP00000265838	0.970	Acetyl-CoA acetyltransferase, mitochondrial
19	9606.ENSP00000005178	0.957	[Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 4, mitochondrial
20	9606.ENSP00000356015	0.955	Acetyl-CoA acetyltransferase, cytosolic

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0140096	1.000	catalytic activity, acting on a protein
GO:0016417	1.000	S-acyltransferase activity
GO:0016407	0.999	acetyltransferase activity
GO:0005515	0.998	protein binding
GO:0016903	0.995	oxidoreductase activity, acting on the aldehyde or oxo group of donors
GO:0004738	0.992	pyruvate dehydrogenase activity
GO:0004742	0.947	dihydrolipoyllysine-residue acetyltransferase activity
GO:0042802	0.634	identical protein binding
GO:0016620	0.590	oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.997	organic substance metabolic process
GO:0044238	0.997	primary metabolic process
GO:0044237	0.997	cellular metabolic process
GO:0006082	0.986	organic acid metabolic process
GO:0006084	0.986	acetyl-CoA metabolic process
GO:0009152	0.985	purine ribonucleotide biosynthetic process
GO:0071616	0.982	acyl-CoA biosynthetic process
GO:0006085	0.963	acetyl-CoA biosynthetic process
GO:0043436	0.896	oxoacid metabolic process
GO:0019752	0.884	carboxylic acid metabolic process
GO:0032787	0.844	monocarboxylic acid metabolic process
GO:0006090	0.795	pyruvate metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.998	mitochondrion
GO:0032991	0.974	protein-containing complex
GO:0070013	0.970	intracellular organelle lumen
GO:1902494	0.869	catalytic complex
GO:0005759	0.802	mitochondrial matrix
GO:1990204	0.724	oxidoreductase complex
GO:0098798	0.486	mitochondrial protein-containing complex
GO:0045254	0.430	pyruvate dehydrogenase complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.3.1.-	1.000	Transferring groups other than amino-acyl groups.
EC:1.2.-.-	0.995	Acting on the aldehyde or oxo group of donors.
RHEA:17017	0.947	(R)-N(6)-dihydrolipoyl-L-lysyl-[protein] + acetyl-CoA = (R)-N(6)-(S(8)-acetyldihydrolipoyl)-L-lysyl-[protein] + CoA
EC:2.3.1.12	0.947	dihydrolipoyllysine-residue acetyltransferase.
EC:1.2.1.-	0.590	With NAD(+) or NADP(+) as acceptor.

[back to server]