StarFunc result for job id P10588

User Input

>input (404 residues)
MAMVTGGWGGPGGDTNGVDKAGGYPRAAEDDSASPPGAASDAEPGDEERPGLQVDCVVCG
DKSSGKHYGVFTCEGCKSFFKRSIRRNLSYTCRSNRDCQIDQHHRNQCQYCRLKKCFRVG
MRKEAVQRGRIPHSLPGAVAASSGSPPGSALAAVASGGDLFPGQPVSELIAQLLRAEPYP
AAAGRFGAGGGAAGAVLGIDNVCELAARLLFSTVEWARHAPFFPELPVADQVALLRLSWS
ELFVLNAAQAALPLHTAPLLAAAGLHAAPMAAERAVAFMDQVRAFQEQVDKLGRLQVDSA
EYGCLKAIALFTPDACGLSDPAHVESLQEKAQVALTEYVRAQYPSQPQRFGRLLLRLPAL
RAVPASLISQLFFMRLVGKTPIETLIRDMLLSGSTFNWPYGSGQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P10588	1.000	1.000	5.175E-55	404	1.000	1.000	P10588.pdb.gz	NR2F6_HUMAN Nuclear receptor subfamily 2 group F member 6 OS=Homo sapiens OX=9606 GN=NR2F6 PE=1 SV=2
2	AFDB:P10589	0.684	0.655	3.323E-38	423	0.644	0.615	P10589.pdb.gz	COT1_HUMAN COUP transcription factor 1 OS=Homo sapiens OX=9606 GN=NR2F1 PE=1 SV=1
3	AFDB:F1D8R0	0.565	0.552	8.324E-38	414	0.644	0.628	F1D8R0.pdb.gz	F1D8R0_HUMAN Ovalbumin upstream promoter-transcription factor II variant 1 OS=Homo sapiens OX=9606 GN=NR2F2 PE=2 SV=1
4	AFDB:Q6PH18	0.587	0.609	9.491E-38	389	0.639	0.663	Q6PH18.pdb.gz	N2F1B_DANRE Nuclear receptor subfamily 2 group F member 1-B OS=Danio rerio OX=7955 GN=nr2f1b PE=2 SV=1
5	AFDB:Q06726	0.555	0.556	2.484E-37	403	0.629	0.630	Q06726.pdb.gz	NR2F5_DANRE Nuclear receptor subfamily 2 group F member 5 OS=Danio rerio OX=7955 GN=nr2f5 PE=2 SV=1
6	AFDB:B3DGQ7	0.556	0.525	4.262E-36	428	0.619	0.584	B3DGQ7.pdb.gz
7	AFDB:P16375	0.607	0.472	1.165E-35	543	0.601	0.448	P16375.pdb.gz	7UP1_DROME Steroid receptor seven-up, isoforms B/C OS=Drosophila melanogaster OX=7227 GN=svp PE=1 SV=1
8	AFDB:Q9Y5X4	0.490	0.483	6.541E-25	410	0.391	0.385	Q9Y5X4.pdb.gz	NR2E3_HUMAN Photoreceptor-specific nuclear receptor OS=Homo sapiens OX=9606 GN=NR2E3 PE=1 SV=1
9	AFDB:F1QGF3	0.462	0.440	3.761E-24	426	0.384	0.364	F1QGF3.pdb.gz
10	AFDB:Q64104	0.502	0.526	4.353E-23	385	0.347	0.364	Q64104.pdb.gz	NR2E1_MOUSE Nuclear receptor subfamily 2 group E member 1 OS=Mus musculus OX=10090 GN=Nr2e1 PE=1 SV=1
11	PDB:3dzyA	0.456	0.569	1.310E-17	302	0.337	0.450	3dzyA.pdb.gz	Structure of the intact PPAR-gamma-RXR- nuclear receptor complex on DNA.
12	PDB:6fx0A	0.402	0.651	6.934E-8	238	0.161	0.273	6fx0A.pdb.gz	Structure-based design of Trifarotene (CD5789), a potent and selective RAR gamma agonist for the treatment of acne.
13	PDB:1g2nA	0.364	0.570	1.523E-7	246	0.173	0.285	1g2nA.pdb.gz	Crystal structure of the ligand-binding domain of the ultraspiracle protein USP, the ortholog of retinoid X receptors in insects.
14	PDB:7kw7F	0.331	0.491	6.363E-5	259	0.131	0.205	7kw7F.pdb.gz	Structure of Hsp90-Hsp70-Hop-GR reveals the Hsp90 client-loading mechanism.
15	PDB:6ikoA	0.106	0.133	4.178E-1	303	0.062	0.083	6ikoA.pdb.gz
16	PDB:7nyrH	0.121	0.156	4.365E-1	270	0.084	0.126	7nyrH.pdb.gz	Structure of Escherichia coli respiratory complex I reconstituted into lipid nanodiscs reveals an uncoupled conformation.
17	PDB:6xz6A	0.140	0.232	4.560E-1	213	0.059	0.113	6xz6A.pdb.gz
18	PDB:3hajA	0.094	0.123	7.377E-1	286	0.079	0.112	3hajA.pdb.gz	Molecular mechanism of membrane constriction and tubulation mediated by the F-BAR protein Pacsin/Syndapin.
19	PDB:2f6lA	0.092	0.177	1.247	166	0.050	0.120	2f6lA.pdb.gz
20	PDB:1rw5A	0.135	0.212	1.302	199	0.059	0.121	1rw5A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A060YH15	0.0	519	391	0.641	0.662	A0A060YH15_ONCMY COUP transcription factor 1 OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00037055001 PE=3 SV=1
2	A0A8I6A7N1	0.0	518	398	0.644	0.653	A0A8I6A7N1_RAT Nuclear receptor subfamily 2, group F, member 1 OS=Rattus norvegicus OX=10116 GN=Nr2f1 PE=3 SV=1
3	F1D8R0	0.0	515	414	0.636	0.621	F1D8R0_HUMAN Ovalbumin upstream promoter-transcription factor II variant 1 OS=Homo sapiens OX=9606 GN=NR2F2 PE=2 SV=1
4	F1DAL7	0.0	517	372	0.631	0.685	F1DAL7_HUMAN Nuclear receptor subfamily 2 group F member 1 OS=Homo sapiens OX=9606 GN=NR2F1 PE=1 SV=1
5	F1DAL9	0.0	521	398	0.644	0.653	F1DAL9_HUMAN Nuclear receptor subfamily 2 group F member 1 OS=Homo sapiens OX=9606 GN=NR2F1 PE=1 SV=1
6	F2Z3S9	0.0	513	420	0.644	0.619	F2Z3S9_RAT Nuclear receptor subfamily 2, group F, member 1 OS=Rattus norvegicus OX=10116 GN=Nr2f1 PE=3 SV=1
7	O09017	0.0	664	390	0.899	0.931	NR2F6_RAT Nuclear receptor subfamily 2 group F member 6 OS=Rattus norvegicus OX=10116 GN=Nr2f6 PE=2 SV=1
8	O09018	0.0	514	414	0.611	0.597	COT2_RAT COUP transcription factor 2 OS=Rattus norvegicus OX=10116 GN=Nr2f2 PE=1 SV=1
9	P10588	0.0	822	404	1.000	1.000	NR2F6_HUMAN Nuclear receptor subfamily 2 group F member 6 OS=Homo sapiens OX=9606 GN=NR2F6 PE=1 SV=2
10	P10589	0.0	514	423	0.646	0.617	COT1_HUMAN COUP transcription factor 1 OS=Homo sapiens OX=9606 GN=NR2F1 PE=1 SV=1
11	P24468	0.0	515	414	0.636	0.621	COT2_HUMAN COUP transcription factor 2 OS=Homo sapiens OX=9606 GN=NR2F2 PE=1 SV=1
12	P43135	0.0	515	414	0.636	0.621	COT2_MOUSE COUP transcription factor 2 OS=Mus musculus OX=10090 GN=Nr2f2 PE=1 SV=2
13	P43136	0.0	671	390	0.913	0.946	NR2F6_MOUSE Nuclear receptor subfamily 2 group F member 6 OS=Mus musculus OX=10090 GN=Nr2f6 PE=1 SV=2
14	Q06725	0.0	521	411	0.646	0.635	N2F1A_DANRE Nuclear receptor subfamily 2 group F member 1-A OS=Danio rerio OX=7955 GN=nr2f1a PE=2 SV=1
15	Q60632	0.0	516	422	0.649	0.621	COT1_MOUSE COUP transcription factor 1 OS=Mus musculus OX=10090 GN=Nr2f1 PE=2 SV=2
16	Q6PH18	0.0	527	389	0.641	0.666	N2F1B_DANRE Nuclear receptor subfamily 2 group F member 1-B OS=Danio rerio OX=7955 GN=nr2f1b PE=2 SV=1
17	Q90733	0.0	517	410	0.658	0.649	COT2_CHICK COUP transcription factor 2 OS=Gallus gallus OX=9031 GN=NR2F2 PE=2 SV=1
18	Q91430	0.0	518	422	0.616	0.590	Q91430_DANRE COUP transcription factor 2 OS=Danio rerio OX=7955 GN=svp[40] PE=1 SV=1
19	Q62681	1.53e-178	505	419	0.639	0.616	Q62681_RAT Orphan receptor COUP-TFI OS=Rattus norvegicus OX=10116 GN=Nr2f1 PE=2 SV=1
20	Q06726	1.10e-176	500	403	0.641	0.643	NR2F5_DANRE Nuclear receptor subfamily 2 group F member 5 OS=Danio rerio OX=7955 GN=nr2f5 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00104 Hormone_recep	6.7e-31	119.1	Ligand-binding domain of nuclear hormone receptor
2	PF00105 zf-C4	8.1e-29	111.2	Zinc finger, C4 type (two domains)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000291442

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000388137	0.864	Metallophosphoesterase domain-containing protein 1
2	9606.ENSP00000471457	0.812	Unconventional myosin-IXb
3	9606.ENSP00000225688	0.759	Dexamethasone-induced Ras-related protein 1
4	9606.ENSP00000377721	0.758	COUP transcription factor 2
5	9606.ENSP00000350833	0.727	Metallophosphoesterase MPPED2
6	9606.ENSP00000341490	0.703	Isthmin-2
7	9606.ENSP00000298231	0.658	Paired mesoderm homeobox protein 2A
8	9606.ENSP00000298699	0.609	Uncharacterized protein C12orf50
9	9606.ENSP00000266744	0.554	Achaete-scute homolog 1
10	9606.ENSP00000226382	0.553	Paired mesoderm homeobox protein 2B
11	9606.ENSP00000262811	0.550	Microtubule associated serine/threonine kinase 3
12	9606.ENSP00000367154	0.526	Ras suppressor protein 1
13	9606.ENSP00000358644	0.518	Protein FAM19A3
14	9606.ENSP00000305631	0.515	Nucleoredoxin-like protein 1
15	9606.ENSP00000263390	0.511	Mediator of RNA polymerase II transcription subunit 26
16	9606.ENSP00000385216	0.504	Nuclear receptor coactivator 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003700	1.000	DNA-binding transcription factor activity
GO:0043565	1.000	sequence-specific DNA binding
GO:0005515	0.999	protein binding
GO:0003690	0.984	double-stranded DNA binding
GO:0000981	0.968	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:1990837	0.966	sequence-specific double-stranded DNA binding
GO:0000976	0.730	transcription cis-regulatory region binding
GO:0038023	0.408	signaling receptor activity
GO:0000977	0.397	RNA polymerase II transcription regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031323	0.995	regulation of cellular metabolic process
GO:0006355	0.992	regulation of DNA-templated transcription
GO:0045892	0.979	negative regulation of DNA-templated transcription
GO:0009987	0.891	cellular process
GO:0006357	0.882	regulation of transcription by RNA polymerase II
GO:0000122	0.781	negative regulation of transcription by RNA polymerase II
GO:0050896	0.400	response to stimulus
GO:0048522	0.351	positive regulation of cellular process
GO:0032501	0.327	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.998	nucleoplasm
GO:0005737	0.789	cytoplasm
GO:0005829	0.362	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]