StarFunc result for job id P10599

User Input

>input (105 residues)
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVD
DCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:H9ZYJ2	0.998	0.998	1.539E-23	105	1.000	1.000	H9ZYJ2.pdb.gz	H9ZYJ2_HUMAN Thioredoxin OS=Homo sapiens OX=9606 GN=TXN PE=2 SV=1
2	AFDB:P10639	0.997	0.997	7.966E-22	105	0.876	0.876	P10639.pdb.gz	THIO_MOUSE Thioredoxin OS=Mus musculus OX=10090 GN=Txn PE=1 SV=3
3	PDB:4pufC	0.971	0.912	4.903E-19	112	1.000	0.938	4pufC.pdb.gz
4	AFDB:Q9DGI3	0.985	0.967	4.833E-18	107	0.610	0.598	Q9DGI3.pdb.gz	THIO_ICTPU Thioredoxin OS=Ictalurus punctatus OX=7998 GN=txn PE=3 SV=1
5	AFDB:Q5XHX6	0.993	0.191	3.035E-17	550	0.590	0.113	Q5XHX6.pdb.gz	TXND2_RAT Thioredoxin domain-containing protein 2 OS=Rattus norvegicus OX=10116 GN=Txndc2 PE=1 SV=2
6	AFDB:Q6P902	0.983	0.202	7.869E-17	515	0.581	0.118	Q6P902.pdb.gz	TXND2_MOUSE Thioredoxin domain-containing protein 2 OS=Mus musculus OX=10090 GN=Txndc2 PE=1 SV=1
7	AFDB:Q86VQ3	0.985	0.188	9.016E-17	553	0.600	0.114	Q86VQ3.pdb.gz	TXND2_HUMAN Thioredoxin domain-containing protein 2 OS=Homo sapiens OX=9606 GN=TXNDC2 PE=1 SV=4
8	AFDB:P22803	0.977	0.986	8.518E-16	104	0.476	0.481	P22803.pdb.gz	TRX2_YEAST Thioredoxin-2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TRX2 PE=1 SV=3
9	AFDB:Q9V429	0.978	0.969	1.927E-15	106	0.505	0.500	Q9V429.pdb.gz	THIO2_DROME Thioredoxin-2 OS=Drosophila melanogaster OX=7227 GN=Trx-2 PE=1 SV=3
10	AFDB:O14463	0.959	0.977	6.561E-15	103	0.476	0.485	O14463.pdb.gz	TRX1_SCHPO Thioredoxin-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=trx1 PE=3 SV=3
11	AFDB:Q69AB1	0.980	0.812	8.613E-15	127	0.533	0.441	Q69AB1.pdb.gz	TXND8_RAT Thioredoxin domain-containing protein 8 OS=Rattus norvegicus OX=10116 GN=Txndc8 PE=2 SV=1
12	PDB:2fa4A	0.967	0.977	1.868E-14	104	0.476	0.481	2fa4A.pdb.gz
13	PDB:1xwaA	0.965	0.914	8.936E-14	111	0.495	0.468	1xwaA.pdb.gz
14	PDB:3f3qA	0.928	0.895	2.480E-13	109	0.457	0.440	3f3qA.pdb.gz	Structural and kinetic analysis of Saccharomyces cerevisiae thioredoxin Trx1: implications for the catalytic mechanism of GSSG reduced by the thioredoxin system
15	PDB:4j56E	0.916	0.916	4.898E-13	105	0.362	0.362	4j56E.pdb.gz	Crystal Structure of the Plasmodium falciparum Thioredoxin Reductase-Thioredoxin Complex.
16	PDB:6z7oA	0.960	0.917	5.612E-13	110	0.419	0.400	6z7oA.pdb.gz	Structures of the germline-specific Deadhead and thioredoxin T proteins from Drosophila melanogaster reveal unique features among thioredoxins.
17	PDB:6zmuA	0.913	0.897	2.213E-11	107	0.362	0.355	6zmuA.pdb.gz
18	PDB:1xflA	0.881	0.817	2.906E-11	114	0.429	0.395	1xflA.pdb.gz
19	PDB:1r26A	0.922	0.859	4.371E-11	113	0.305	0.283	1r26A.pdb.gz
20	PDB:6yt3B	0.864	0.256	9.343E-10	376	0.257	0.072	6yt3B.pdb.gz	Chimeric single alpha-helical domains as rigid fusion protein connections for protein nanotechnology and structural biology.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	H9ZYJ2	2.18e-73	214	105	1.000	1.000	H9ZYJ2_HUMAN Thioredoxin OS=Homo sapiens OX=9606 GN=TXN PE=2 SV=1
2	P10599	2.18e-73	214	105	1.000	1.000	THIO_HUMAN Thioredoxin OS=Homo sapiens OX=9606 GN=TXN PE=1 SV=3
3	P11232	5.91e-65	193	105	0.886	0.886	THIO_RAT Thioredoxin OS=Rattus norvegicus OX=10116 GN=Txn PE=1 SV=2
4	P10639	1.57e-64	192	105	0.876	0.876	THIO_MOUSE Thioredoxin OS=Mus musculus OX=10090 GN=Txn PE=1 SV=3
5	Q9DGI3	1.22e-43	139	107	0.619	0.607	THIO_ICTPU Thioredoxin OS=Ictalurus punctatus OX=7998 GN=txn PE=3 SV=1
6	Q86VQ3	1.60e-38	136	553	0.600	0.114	TXND2_HUMAN Thioredoxin domain-containing protein 2 OS=Homo sapiens OX=9606 GN=TXNDC2 PE=1 SV=4
7	Q6P902	9.67e-38	134	515	0.581	0.118	TXND2_MOUSE Thioredoxin domain-containing protein 2 OS=Mus musculus OX=10090 GN=Txndc2 PE=1 SV=1
8	Q5XHX6	1.77e-37	134	550	0.590	0.113	TXND2_RAT Thioredoxin domain-containing protein 2 OS=Rattus norvegicus OX=10116 GN=Txndc2 PE=1 SV=2
9	Q69AB1	1.29e-32	112	127	0.543	0.449	TXND8_RAT Thioredoxin domain-containing protein 8 OS=Rattus norvegicus OX=10116 GN=Txndc8 PE=2 SV=1
10	Q9V429	7.94e-31	107	106	0.505	0.500	THIO2_DROME Thioredoxin-2 OS=Drosophila melanogaster OX=7227 GN=Trx-2 PE=1 SV=3
11	P22803	2.82e-30	105	104	0.476	0.481	TRX2_YEAST Thioredoxin-2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TRX2 PE=1 SV=3
12	Q69AB2	2.37e-29	103	127	0.514	0.425	TXND8_MOUSE Thioredoxin domain-containing protein 8 OS=Mus musculus OX=10090 GN=Txndc8 PE=1 SV=1
13	O14463	1.22e-28	101	103	0.476	0.485	TRX1_SCHPO Thioredoxin-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=trx1 PE=3 SV=3
14	Q9C9Y6	2.59e-28	101	140	0.457	0.343	TRXH9_ARATH Thioredoxin H9 OS=Arabidopsis thaliana OX=3702 GN=TRX9 PE=1 SV=1
15	Q4WV97	2.16e-27	98.6	110	0.505	0.482	Q4WV97_ASPFU Thioredoxin OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_5G11320 PE=3 SV=1
16	Q6A555	3.63e-27	98.6	127	0.514	0.425	TXND8_HUMAN Thioredoxin domain-containing protein 8 OS=Homo sapiens OX=9606 GN=TXNDC8 PE=1 SV=2
17	P22217	7.84e-27	97.1	103	0.457	0.466	TRX1_YEAST Thioredoxin-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TRX1 PE=1 SV=3
18	Q6FND5	9.43e-27	96.7	103	0.467	0.476	Q6FND5_CANGA Thioredoxin OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=TRX2 PE=3 SV=1
19	P29448	1.99e-26	96.3	114	0.390	0.360	TRXH1_ARATH Thioredoxin H1 OS=Arabidopsis thaliana OX=3702 GN=TRX1 PE=1 SV=1
20	Q38879	2.47e-26	96.7	133	0.381	0.301	TRXH2_ARATH Thioredoxin H2 OS=Arabidopsis thaliana OX=3702 GN=TRX2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00578 AhpC-TSA	39	15.6	AhpC/TSA family
2	PF02966 DIM1	0.097	23.9	Mitosis protein DIM1
3	PF00462 Glutaredoxin	5.5	18.6	Glutaredoxin
4	PF04756 OST3_OST6	1.3	19.9	OST3 / OST6 family, transporter family
5	PF08534 Redoxin	1.1e+02	13.9	Redoxin
6	PF00085 Thioredoxin	1.1e-28	110.6	Thioredoxin
7	PF13098 Thioredoxin_2	0.74	21.7	Thioredoxin-like domain
8	PF13899 Thioredoxin_7	0.44	22.1	Thioredoxin-like
9	PF13905 Thioredoxin_8	0.1	24.2	Thioredoxin-like
10	PF14595 Thioredoxin_9	4	18.7	Thioredoxin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9601.ENSPPYP00000021834

Rank	PPI partner	STRING score	Description
1	9601.ENSPPYP00000001080	0.998	May act as an oxidative stress mediator by inhibiting thioredoxin activity or by limiting its bioavailability. Interacts with COPS5 and restores COPS5-induced suppression of CDKN1B stability, blocking the COPS5-mediated translocation of CDKN1B from the nucleus to the cytoplasm. Inhibits the proteasomal degradation of DDIT4, and thereby contributes to the inhibition of the mammalian target of rapamycin complex 1 (mTORC1) (By similarity). Functions as a transcriptional repressor, possibly by acting as a bridge molecule between transcription factors and corepressor complexes, and over- ex [...]
2	9601.ENSPPYP00000019077	0.990	Mitogen-activated protein kinase kinase kinase 5
3	9601.ENSPPYP00000006334	0.978	DNA-(apurinic or apyrimidinic site) lyase
4	9601.ENSPPYP00000005584	0.954	Belongs to the class-I pyridine nucleotide-disulfide oxidoreductase family
5	9601.ENSPPYP00000016712	0.934	Nuclear factor of kappa light polypeptide gene enhancer in B-cells 1
6	9601.ENSPPYP00000015043	0.925	annotation not available
7	9601.ENSPPYP00000001637	0.921	Peroxiredoxin 1
8	9601.ENSPPYP00000024125	0.908	Peroxiredoxin-2
9	9601.ENSPPYP00000020577	0.882	Methionine sulfoxide reductase A
10	9601.ENSPPYP00000003152	0.852	Thioredoxin-dependent peroxide reductase, mitochondrial
11	9601.ENSPPYP00000000034	0.843	NLR family, pyrin domain containing 3
12	9601.ENSPPYP00000012925	0.842	Uncharacterized protein
13	9601.ENSPPYP00000017490	0.836	Glutaredoxin (thioltransferase)
14	9601.ENSPPYP00000012676	0.833	Superoxide dismutase [Cu-Zn]
15	9601.ENSPPYP00000003590	0.830	Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides
16	9601.ENSPPYP00000022570	0.819	Mitogen-activated protein kinase kinase kinase 15
17	9601.ENSPPYP00000022589	0.819	Peroxiredoxin 4
18	9601.ENSPPYP00000020725	0.808	Glutathione reductase
19	9601.ENSPPYP00000000449	0.761	Glutathione-dependent oxidoreductase that facilitates the maintenance of mitochondrial redox homeostasis upon induction of apoptosis by oxidative stress. Involved in response to hydrogen peroxide and regulation of apoptosis caused by oxidative stress. Acts as a very efficient catalyst of monothiol reactions because of its high affinity for protein glutathione-mixed disulfides. Can receive electrons not only from glutathione (GSH), but also from thioredoxin reductase supporting both monothiol and dithiol reactions. Efficiently catalyzes both glutathionylation and deglutathionylation of [...]
20	9601.ENSPPYP00000018379	0.734	Belongs to the tumor necrosis factor family.

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0015035	1.000	protein-disulfide reductase activity
GO:0016209	0.998	antioxidant activity
GO:0047134	0.978	protein-disulfide reductase (NAD(P)) activity
GO:0004791	0.861	thioredoxin-disulfide reductase activity
GO:1901363	0.437	heterocyclic compound binding
GO:0097159	0.417	organic cyclic compound binding
GO:0042802	0.405	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.987	cellular process
GO:0042592	0.985	homeostatic process
GO:0050896	0.984	response to stimulus
GO:0050794	0.971	regulation of cellular process
GO:0019222	0.950	regulation of metabolic process
GO:0019725	0.938	cellular homeostasis
GO:0060255	0.922	regulation of macromolecule metabolic process
GO:0048519	0.878	negative regulation of biological process
GO:0080090	0.866	regulation of primary metabolic process
GO:0031323	0.863	regulation of cellular metabolic process
GO:0042221	0.847	response to chemical
GO:0048523	0.841	negative regulation of cellular process
GO:0048518	0.834	positive regulation of biological process
GO:0051716	0.780	cellular response to stimulus
GO:1901700	0.756	response to oxygen-containing compound
GO:0051171	0.700	regulation of nitrogen compound metabolic process
GO:0008152	0.699	metabolic process
GO:0006950	0.645	response to stress
GO:0071704	0.607	organic substance metabolic process
GO:0045454	0.605	cell redox homeostasis
GO:0010035	0.572	response to inorganic substance
GO:0044238	0.570	primary metabolic process
GO:0006807	0.547	nitrogen compound metabolic process
GO:0048522	0.520	positive regulation of cellular process
GO:0070887	0.470	cellular response to chemical stimulus
GO:0044237	0.466	cellular metabolic process
GO:0010604	0.456	positive regulation of macromolecule metabolic process
GO:0048583	0.451	regulation of response to stimulus
GO:1901698	0.442	response to nitrogen compound
GO:0010468	0.428	regulation of gene expression
GO:0043170	0.420	macromolecule metabolic process
GO:0009889	0.373	regulation of biosynthetic process
GO:0051246	0.329	regulation of protein metabolic process
GO:0051173	0.329	positive regulation of nitrogen compound metabolic process
GO:0032501	0.323	multicellular organismal process
GO:0031325	0.323	positive regulation of cellular metabolic process
GO:0065009	0.318	regulation of molecular function
GO:0009966	0.316	regulation of signal transduction
GO:0010033	0.315	response to organic substance
GO:0031326	0.301	regulation of cellular biosynthetic process
GO:0019219	0.301	regulation of nucleobase-containing compound metabolic process
GO:0010556	0.300	regulation of macromolecule biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0070013	0.996	intracellular organelle lumen
GO:0005654	0.990	nucleoplasm
GO:0031982	0.598	vesicle
GO:0005576	0.561	extracellular region
GO:0070062	0.365	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.8.-.-	1.000	Acting on a sulfur group of donors.
EC:1.8.1.8	0.978	protein-disulfide reductase.
RHEA:20345	0.861	[thioredoxin]-dithiol + NADP(+) = [thioredoxin]-disulfide + H(+) + NADPH
EC:1.8.1.9	0.861	thioredoxin-disulfide reductase.

[back to server]