StarFunc result for job id P10600

User Input

>input (412 residues)
MKMHLQRALVVLALLNFATVSLSLSTCTTLDFGHIKKKRVEAIRGQILSKLRLTSPPEPT
VMTHVPYQVLALYNSTRELLEEMHGEREEGCTQENTESEYYAKEIHKFDMIQGLAEHNEL
AVCPKGITSKVFRFNVSSVEKNRTNLFRAEFRVLRVPNPSSKRNEQRIELFQILRPDEHI
AKQRYIGGKNLPTRGTAEWLSFDVTDTVREWLLRRESNLGLEISIHCPCHTFQPNGDILE
NIHEVMEIKFKGVDNEDDHGRGDLGRLKKQKDHHNPHLILMMIPPHRLDNPGQGGQRKKR
ALDTNYCFRNLEENCCVRPLYIDFRQDLGWKWVHEPKGYYANFCSGPCPYLRSADTTHST
VLGLYNTLNPEASASPCCVPQDLEPLTILYYVGRTPKVEQLSNMVVKSCKCS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A5YM40	0.660	0.660	1.654E-66	412	1.000	1.000	A5YM40.pdb.gz	A5YM40_HUMAN Transforming growth factor beta OS=Homo sapiens OX=9606 GN=TGFB3 PE=2 SV=1
2	AFDB:P16047	0.920	0.920	1.948E-66	412	0.874	0.874	P16047.pdb.gz	TGFB3_CHICK Transforming growth factor beta-3 proprotein OS=Gallus gallus OX=9031 GN=TGFB3 PE=2 SV=2
3	AFDB:Q66I23	0.902	0.906	4.063E-60	410	0.733	0.737	Q66I23.pdb.gz	Q66I23_DANRE Transforming growth factor beta OS=Danio rerio OX=7955 GN=wu:fc78g09 PE=2 SV=1
4	AFDB:P09858	0.442	0.420	2.658E-45	435	0.553	0.524	P09858.pdb.gz	TGFB2_PIG Transforming growth factor beta-2 proprotein OS=Sus scrofa OX=9823 GN=TGFB2 PE=1 SV=2
5	AFDB:Q07257	0.437	0.410	8.695E-44	442	0.553	0.516	Q07257.pdb.gz	TGFB2_RAT Transforming growth factor beta-2 proprotein OS=Rattus norvegicus OX=10116 GN=Tgfb2 PE=2 SV=2
6	AFDB:F8W4A6	0.452	0.451	2.319E-43	413	0.556	0.554	F8W4A6.pdb.gz
7	AFDB:E9QHW0	0.774	0.836	1.255E-34	379	0.410	0.446	E9QHW0.pdb.gz	E9QHW0_DANRE Transforming growth factor beta OS=Danio rerio OX=7955 GN=tgfb1b PE=3 SV=1
8	AFDB:P04202	0.404	0.426	7.176E-34	390	0.451	0.477	P04202.pdb.gz	TGFB1_MOUSE Transforming growth factor beta-1 proprotein OS=Mus musculus OX=10090 GN=Tgfb1 PE=1 SV=1
9	AFDB:F1R741	0.763	0.829	7.578E-34	377	0.391	0.427	F1R741.pdb.gz
10	AFDB:P01137	0.405	0.426	1.539E-33	390	0.451	0.477	P01137.pdb.gz	TGFB1_HUMAN Transforming growth factor beta-1 proprotein OS=Homo sapiens OX=9606 GN=TGFB1 PE=1 SV=3
11	PDB:3rjrC	0.428	0.505	1.937E-27	343	0.430	0.516	3rjrC.pdb.gz
12	PDB:5ffoG	0.413	0.557	7.462E-26	297	0.381	0.529	5ffoG.pdb.gz	Force interacts with macromolecular structure in activation of TGF-beta.
13	PDB:5vqfB	0.420	0.528	2.613E-25	320	0.408	0.525	5vqfB.pdb.gz
14	PDB:7y1rB	0.397	0.518	1.252E-23	308	0.400	0.536	7y1rB.pdb.gz
15	PDB:5ntuA	0.270	0.350	7.872E-18	308	0.233	0.312	5ntuA.pdb.gz
16	PDB:5nxsA	0.259	0.353	1.137E-16	290	0.209	0.297	5nxsA.pdb.gz
17	PDB:5hlyA	0.259	0.344	1.339E-16	299	0.199	0.274	5hlyA.pdb.gz
18	PDB:6umxA	0.266	0.379	3.982E-16	279	0.206	0.305	6umxA.pdb.gz
19	PDB:5nxsB	0.245	0.381	2.437E-12	251	0.204	0.335	5nxsB.pdb.gz
20	PDB:6q2sA	0.169	0.564	4.945E-4	98	0.058	0.245	6q2sA.pdb.gz	Cryo-EM analyses reveal the common mechanism and diversification in the activation of RET by different ligands.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A5YM40	0.0	862	412	1.000	1.000	A5YM40_HUMAN Transforming growth factor beta OS=Homo sapiens OX=9606 GN=TGFB3 PE=2 SV=1
2	P10600	0.0	862	412	1.000	1.000	TGFB3_HUMAN Transforming growth factor beta-3 proprotein OS=Homo sapiens OX=9606 GN=TGFB3 PE=1 SV=1
3	P16047	0.0	744	412	0.874	0.874	TGFB3_CHICK Transforming growth factor beta-3 proprotein OS=Gallus gallus OX=9031 GN=TGFB3 PE=2 SV=2
4	P17125	0.0	841	410	0.971	0.976	TGFB3_MOUSE Transforming growth factor beta-3 proprotein OS=Mus musculus OX=10090 GN=Tgfb3 PE=1 SV=1
5	Q07258	0.0	847	412	0.978	0.978	TGFB3_RAT Transforming growth factor beta-3 proprotein OS=Rattus norvegicus OX=10116 GN=Tgfb3 PE=2 SV=2
6	Q66I23	0.0	638	410	0.735	0.739	Q66I23_DANRE Transforming growth factor beta OS=Danio rerio OX=7955 GN=wu:fc78g09 PE=2 SV=1
7	P27090	3.86e-165	471	414	0.553	0.551	TGFB2_MOUSE Transforming growth factor beta-2 proprotein OS=Mus musculus OX=10090 GN=Tgfb2 PE=1 SV=2
8	P61812	5.33e-160	458	414	0.549	0.546	TGFB2_HUMAN Transforming growth factor beta-2 proprotein OS=Homo sapiens OX=9606 GN=TGFB2 PE=1 SV=1
9	Q07257	1.14e-159	459	442	0.556	0.518	TGFB2_RAT Transforming growth factor beta-2 proprotein OS=Rattus norvegicus OX=10116 GN=Tgfb2 PE=2 SV=2
10	B2R7T2	1.50e-159	457	414	0.549	0.546	B2R7T2_HUMAN Transforming growth factor beta OS=Homo sapiens OX=9606 PE=2 SV=1
11	P09858	1.94e-159	457	435	0.549	0.520	TGFB2_PIG Transforming growth factor beta-2 proprotein OS=Sus scrofa OX=9823 GN=TGFB2 PE=1 SV=2
12	P30371	1.17e-158	455	412	0.549	0.549	TGFB2_CHICK Transforming growth factor beta-2 proprotein OS=Gallus gallus OX=9031 GN=TGFB2 PE=3 SV=1
13	Q6T7C3	2.32e-155	447	442	0.553	0.516	Q6T7C3_RABIT Transforming growth factor beta OS=Oryctolagus cuniculus OX=9986 PE=2 SV=1
14	Q7SZV4	1.79e-149	431	411	0.529	0.530	Q7SZV4_DANRE Transforming growth factor beta OS=Danio rerio OX=7955 GN=tgfb2 PE=2 SV=1
15	P17246	4.43e-107	323	390	0.454	0.479	TGFB1_RAT Transforming growth factor beta-1 proprotein OS=Rattus norvegicus OX=10116 GN=Tgfb1 PE=1 SV=1
16	P04202	5.80e-106	320	390	0.449	0.474	TGFB1_MOUSE Transforming growth factor beta-1 proprotein OS=Mus musculus OX=10090 GN=Tgfb1 PE=1 SV=1
17	P18341	1.19e-105	319	390	0.449	0.474	TGFB1_BOVIN Transforming growth factor beta-1 proprotein OS=Bos taurus OX=9913 GN=TGFB1 PE=1 SV=2
18	P09531	6.30e-103	312	391	0.454	0.478	TGFB1_CHICK Transforming growth factor beta-1 proprotein OS=Gallus gallus OX=9031 GN=TGFB1 PE=2 SV=3
19	P07200	5.84e-101	307	390	0.437	0.462	TGFB1_PIG Transforming growth factor beta-1 proprotein OS=Sus scrofa OX=9823 GN=TGFB1 PE=1 SV=2
20	P01137	8.03e-100	304	390	0.432	0.456	TGFB1_HUMAN Transforming growth factor beta-1 proprotein OS=Homo sapiens OX=9606 GN=TGFB1 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00688 TGFb_propeptide	3.5e-33	126.8	TGF-beta propeptide
2	PF00019 TGF_beta	1.4e-21	88.7	Transforming growth factor beta like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000020116

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000005036	0.998	TGF-beta receptor type-2
2	61853.ENSNLEP00000020704	0.998	Receptor protein serine/threonine kinase
3	61853.ENSNLEP00000021573	0.974	Serine/threonine-protein kinase receptor
4	61853.ENSNLEP00000019359	0.952	Latent transforming growth factor beta binding protein 1
5	61853.ENSNLEP00000016659	0.929	Transforming growth factor, beta 1
6	61853.ENSNLEP00000006808	0.913	Decorin
7	61853.ENSNLEP00000021247	0.911	Endoglin
8	61853.ENSNLEP00000021570	0.891	Receptor protein serine/threonine kinase
9	61853.ENSNLEP00000022006	0.886	Fibromodulin
10	61853.ENSNLEP00000012631	0.879	Transforming growth factor, beta receptor III
11	61853.ENSNLEP00000013966	0.867	Mothers against decapentaplegic homolog
12	61853.ENSNLEP00000015776	0.845	Mothers against decapentaplegic homolog
13	61853.ENSNLEP00000014415	0.840	Mothers against decapentaplegic homolog
14	61853.ENSNLEP00000016715	0.823	Left-right determination factor 1
15	61853.ENSNLEP00000003813	0.822	Inhibin, beta A
16	61853.ENSNLEP00000018508	0.822	TGF-beta activated kinase 1/MAP3K7 binding protein 1
17	61853.ENSNLEP00000001091	0.821	Inhibin, beta B
18	61853.ENSNLEP00000017678	0.820	Connective tissue growth factor
19	61853.ENSNLEP00000021052	0.806	Inhibin, beta E
20	61853.ENSNLEP00000021056	0.806	Inhibin, beta C

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005160	0.998	transforming growth factor beta receptor binding
GO:0042802	0.863	identical protein binding
GO:0098772	0.803	molecular function regulator activity
GO:0140677	0.739	molecular function activator activity
GO:0048018	0.615	receptor ligand activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.990	regulation of cellular process
GO:0051239	0.988	regulation of multicellular organismal process
GO:0050793	0.988	regulation of developmental process
GO:0032501	0.986	multicellular organismal process
GO:0009987	0.986	cellular process
GO:0048856	0.986	anatomical structure development
GO:0050896	0.984	response to stimulus
GO:0048519	0.981	negative regulation of biological process
GO:0048518	0.980	positive regulation of biological process
GO:0048522	0.973	positive regulation of cellular process
GO:0042127	0.944	regulation of cell population proliferation
GO:0007275	0.941	multicellular organism development
GO:0045595	0.936	regulation of cell differentiation
GO:0030278	0.933	regulation of ossification
GO:2000026	0.929	regulation of multicellular organismal development
GO:0048523	0.925	negative regulation of cellular process
GO:0048513	0.913	animal organ development
GO:0019222	0.908	regulation of metabolic process
GO:0009719	0.906	response to endogenous stimulus
GO:0048731	0.887	system development
GO:0008285	0.884	negative regulation of cell population proliferation
GO:0009966	0.869	regulation of signal transduction
GO:0009653	0.866	anatomical structure morphogenesis
GO:0051246	0.859	regulation of protein metabolic process
GO:0048869	0.855	cellular developmental process
GO:0045597	0.855	positive regulation of cell differentiation
GO:0030154	0.854	cell differentiation
GO:0010717	0.847	regulation of epithelial to mesenchymal transition
GO:0070848	0.842	response to growth factor
GO:0051716	0.842	cellular response to stimulus
GO:0007165	0.832	signal transduction
GO:0010718	0.831	positive regulation of epithelial to mesenchymal transition
GO:0051174	0.803	regulation of phosphorus metabolic process
GO:0061035	0.802	regulation of cartilage development
GO:0060322	0.787	head development
GO:0031399	0.775	regulation of protein modification process
GO:0045893	0.772	positive regulation of DNA-templated transcription
GO:0009887	0.766	animal organ morphogenesis
GO:0040012	0.746	regulation of locomotion
GO:0048468	0.741	cell development
GO:0006950	0.734	response to stress
GO:0071495	0.725	cellular response to endogenous stimulus
GO:0071840	0.712	cellular component organization or biogenesis
GO:0010171	0.712	body morphogenesis
GO:0051128	0.704	regulation of cellular component organization
GO:0010941	0.701	regulation of cell death
GO:0060485	0.700	mesenchyme development
GO:2000145	0.695	regulation of cell motility
GO:0071363	0.644	cellular response to growth factor stimulus
GO:0060323	0.639	head morphogenesis
GO:0019220	0.636	regulation of phosphate metabolic process
GO:0060324	0.589	face development
GO:0030334	0.588	regulation of cell migration
GO:0009790	0.584	embryo development
GO:0060325	0.574	face morphogenesis
GO:0035295	0.573	tube development
GO:0072359	0.569	circulatory system development
GO:0007166	0.562	cell surface receptor signaling pathway
GO:0016043	0.536	cellular component organization
GO:0010605	0.529	negative regulation of macromolecule metabolic process
GO:0010712	0.522	regulation of collagen metabolic process
GO:0090092	0.522	regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0042221	0.519	response to chemical
GO:0048584	0.500	positive regulation of response to stimulus
GO:0010647	0.500	positive regulation of cell communication
GO:0023056	0.499	positive regulation of signaling
GO:0030335	0.471	positive regulation of cell migration
GO:0008152	0.448	metabolic process
GO:0007167	0.442	enzyme-linked receptor protein signaling pathway
GO:0042325	0.440	regulation of phosphorylation
GO:0048565	0.438	digestive tract development
GO:0009967	0.436	positive regulation of signal transduction
GO:0065009	0.427	regulation of molecular function
GO:0007507	0.386	heart development
GO:0030097	0.382	hemopoiesis
GO:0048568	0.376	embryonic organ development
GO:0048863	0.362	stem cell differentiation
GO:0002244	0.346	hematopoietic progenitor cell differentiation
GO:0051247	0.334	positive regulation of protein metabolic process
GO:0007178	0.328	transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0071704	0.319	organic substance metabolic process
GO:0008284	0.309	positive regulation of cell population proliferation
GO:0001932	0.306	regulation of protein phosphorylation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071944	0.999	cell periphery
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0005737	0.998	cytoplasm
GO:0012505	0.993	endomembrane system
GO:0005576	0.977	extracellular region
GO:0016020	0.962	membrane
GO:0070013	0.932	intracellular organelle lumen
GO:0005886	0.908	plasma membrane
GO:0031982	0.904	vesicle
GO:0031012	0.808	extracellular matrix
GO:0097708	0.683	intracellular vesicle
GO:0031410	0.659	cytoplasmic vesicle
GO:0005634	0.637	nucleus
GO:0005615	0.540	extracellular space
GO:0099503	0.535	secretory vesicle
GO:0030141	0.522	secretory granule
GO:0062023	0.352	collagen-containing extracellular matrix

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]