StarFunc result for job id P10606

User Input

>input (129 residues)
MASRLLRGAGTLAAQALRARGPSGAAAMRSMASGGGVPTDEEQATGLEREIMLAAKKGLD
PYNVLAPKGASGTREDPNLVPSISNKRIVGCICEEDNTSVVWFWLHKGEAQRCPRCGAHY
KLVPQQLAH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A384NL93	0.800	0.800	3.542E-24	129	1.000	1.000	A0A384NL93.pdb.gz	A0A384NL93_HUMAN Cytochrome c oxidase subunit 5B, mitochondrial OS=Homo sapiens OX=9606 PE=2 SV=1
2	AFDB:P12075	0.795	0.795	3.496E-23	129	0.814	0.814	P12075.pdb.gz	COX5B_RAT Cytochrome c oxidase subunit 5B, mitochondrial OS=Rattus norvegicus OX=10116 GN=Cox5b PE=1 SV=2
3	AFDB:P00428	0.840	0.840	9.326E-23	129	0.829	0.829	P00428.pdb.gz	COX5B_BOVIN Cytochrome c oxidase subunit 5B, mitochondrial OS=Bos taurus OX=9913 GN=COX5B PE=1 SV=2
4	PDB:7dgqA5	0.717	0.936	6.195E-17	98	0.651	0.857	7dgqA5.pdb.gz	A Dynamic Substrate Pool Revealed by cryo-EM of a Lipid-Preserved Respiratory Supercomplex.
5	AFDB:P90849	0.617	0.604	7.866E-10	132	0.341	0.333	P90849.pdb.gz	P90849_CAEEL COX5B-domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=cox-5b PE=1 SV=1
6	AFDB:Q9VMB9	0.578	0.615	3.107E-9	120	0.326	0.350	Q9VMB9.pdb.gz	Q9VMB9_DROME Cytochrome c oxidase subunit 5B, isoform A OS=Drosophila melanogaster OX=7227 GN=COX5B PE=1 SV=1
7	AFDB:Q5ALV5	0.595	0.504	8.180E-8	157	0.295	0.242	Q5ALV5.pdb.gz	Q5ALV5_CANAL Cytochrome c oxidase subunit IV OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=COX4 PE=4 SV=1
8	AFDB:P92683	0.525	0.415	9.954E-8	169	0.403	0.308	P92683.pdb.gz	P92683_ORYSJ Cytochrome c oxidase subunit Vb OS=Oryza sativa subsp. japonica OX=39947 GN=coxVb PE=1 SV=1
9	AFDB:G8BCY3	0.583	0.500	1.474E-7	154	0.302	0.253	G8BCY3.pdb.gz	G8BCY3_CANPC Cytochrome c oxidase polypeptide IV, mitochondrial OS=Candida parapsilosis (strain CDC 317 / ATCC MYA-4646) OX=578454 GN=COX4 PE=4 SV=1
10	AFDB:Q9LW15	0.505	0.384	3.450E-7	176	0.333	0.244	Q9LW15.pdb.gz	CX5B1_ARATH Cytochrome c oxidase subunit 5b-1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=COX5B-1 PE=1 SV=1
11	AFDB:Q9SSB8	0.521	0.408	6.635E-7	171	0.326	0.246	Q9SSB8.pdb.gz	CX5B2_ARATH Cytochrome c oxidase subunit 5b-2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=COX5B-2 PE=1 SV=1
12	PDB:7qskR	0.269	0.345	1.764E-1	96	0.078	0.104	7qskR.pdb.gz	Cryo-EM structures define ubiquinone-10 binding to mitochondrial complex I and conformational transitions accompanying Q-site occupancy.
13	PDB:2l6lA	0.276	0.237	5.024E-1	155	0.132	0.110	2l6lA.pdb.gz	Structure and mechanistic insights into novel iron-mediated moonlighting functions of human J-protein cochaperone, Dph4.
14	PDB:7b93R	0.251	0.319	5.024E-1	96	0.093	0.125	7b93R.pdb.gz	Cork-in-bottle mechanism of inhibitor binding to mammalian complex I.
15	PDB:2jr7A	0.236	0.342	1.340	84	0.093	0.143	2jr7A.pdb.gz	Solution structure of human DESR1, a CSL zinc-binding protein
16	PDB:4d4oA	0.240	0.082	1.631	414	0.062	0.019	4d4oA.pdb.gz	Structure of the Kti11/Kti13 Heterodimer and its Double Role in Modifications of tRNA and Eukaryotic Elongation Factor 2.
17	PDB:5mj3A	0.192	0.099	3.349	302	0.054	0.023	5mj3A.pdb.gz
18	PDB:7anwA	0.129	0.030	3.575	645	0.085	0.017	7anwA.pdb.gz	Structural basis for SARM1 inhibition and activation under energetic stress.
19	PDB:7eu1E	0.123	0.082	3.575	199	0.054	0.035	7eu1E.pdb.gz	Pol IV and RDR2: A two-RNA-polymerase machine that produces double-stranded RNA.
20	PDB:3j6bX	0.185	0.338	3.817	64	0.047	0.094	3j6bX.pdb.gz	Structure of the yeast mitochondrial large ribosomal subunit.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A384NL93	4.36e-93	266	129	1.000	1.000	A0A384NL93_HUMAN Cytochrome c oxidase subunit 5B, mitochondrial OS=Homo sapiens OX=9606 PE=2 SV=1
2	P10606	4.36e-93	266	129	1.000	1.000	COX5B_HUMAN Cytochrome c oxidase subunit 5B, mitochondrial OS=Homo sapiens OX=9606 GN=COX5B PE=1 SV=2
3	P00428	2.40e-81	236	129	0.829	0.829	COX5B_BOVIN Cytochrome c oxidase subunit 5B, mitochondrial OS=Bos taurus OX=9913 GN=COX5B PE=1 SV=2
4	P12075	1.35e-78	229	129	0.814	0.814	COX5B_RAT Cytochrome c oxidase subunit 5B, mitochondrial OS=Rattus norvegicus OX=10116 GN=Cox5b PE=1 SV=2
5	P19536	5.80e-77	225	128	0.829	0.836	COX5B_MOUSE Cytochrome c oxidase subunit 5B, mitochondrial OS=Mus musculus OX=10090 GN=Cox5b PE=1 SV=1
6	Q9VMB9	1.16e-23	90.1	120	0.333	0.358	Q9VMB9_DROME Cytochrome c oxidase subunit 5B, isoform A OS=Drosophila melanogaster OX=7227 GN=COX5B PE=1 SV=1
7	P92683	2.29e-16	72.8	169	0.295	0.225	P92683_ORYSJ Cytochrome c oxidase subunit Vb OS=Oryza sativa subsp. japonica OX=39947 GN=coxVb PE=1 SV=1
8	P79010	1.06e-14	68.6	164	0.295	0.232	COX4_SCHPO Cytochrome c oxidase subunit 4, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cox4 PE=1 SV=1
9	Q9SSB8	6.83e-14	66.6	171	0.271	0.205	CX5B2_ARATH Cytochrome c oxidase subunit 5b-2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=COX5B-2 PE=1 SV=1
10	P90849	7.81e-14	65.5	132	0.302	0.295	P90849_CAEEL COX5B-domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=cox-5b PE=1 SV=1
11	Q5ALV5	2.12e-13	64.7	157	0.271	0.223	Q5ALV5_CANAL Cytochrome c oxidase subunit IV OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=COX4 PE=4 SV=1
12	Q9LW15	7.99e-12	61.2	176	0.217	0.159	CX5B1_ARATH Cytochrome c oxidase subunit 5b-1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=COX5B-1 PE=1 SV=1
13	G8BCY3	2.94e-11	59.3	154	0.256	0.214	G8BCY3_CANPC Cytochrome c oxidase polypeptide IV, mitochondrial OS=Candida parapsilosis (strain CDC 317 / ATCC MYA-4646) OX=578454 GN=COX4 PE=4 SV=1
14	P04037	3.99e-10	56.2	155	0.271	0.226	COX4_YEAST Cytochrome c oxidase subunit 4, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=COX4 PE=1 SV=1
15	Q9LFL6	1.7	30.4	336	0.109	0.042	BKN2_ARATH Inactive serine/threonine-protein kinase BKN2 OS=Arabidopsis thaliana OX=3702 GN=BKN2 PE=1 SV=1
16	Q18806	2.5	30.0	487	0.093	0.025	RIG3_CAEEL Neuronal immunoglobulin domain-containing protein rig-3 OS=Caenorhabditis elegans OX=6239 GN=rig-3 PE=1 SV=1
17	Q57XU5	2.8	30.0	1317	0.155	0.015	Q57XU5_TRYB2 Ankyrin repeat protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.21H15.60 PE=4 SV=1
18	P07813	4.7	29.3	860	0.116	0.017	SYL_ECOLI Leucine--tRNA ligase OS=Escherichia coli (strain K12) OX=83333 GN=leuS PE=1 SV=2
19	Q96CK0	6.5	28.9	615	0.147	0.031	ZN653_HUMAN Zinc finger protein 653 OS=Homo sapiens OX=9606 GN=ZNF653 PE=1 SV=1
20	O95602	8.2	28.5	1720	0.078	0.006	RPA1_HUMAN DNA-directed RNA polymerase I subunit RPA1 OS=Homo sapiens OX=9606 GN=POLR1A PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01215 COX5B	3.1e-30	115.9	Cytochrome c oxidase subunit Vb

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000258424

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000229379	0.999	Cytochrome c oxidase subunit 6A1, mitochondrial
2	9606.ENSP00000246554	0.999	Cytochrome c oxidase subunit 6B1
3	9606.ENSP00000317780	0.999	Cytochrome c oxidase subunit 5A, mitochondrial
4	9606.ENSP00000354876	0.999	Cytochrome c oxidase subunit 2
5	9606.ENSP00000367939	0.999	Cytochrome b-c1 complex subunit 8
6	9606.ENSP00000425759	0.999	Cytochrome c oxidase subunit 7C, mitochondrial
7	9606.ENSP00000428895	0.999	Cytochrome c oxidase subunit 6C
8	9606.ENSP00000457513	0.999	Cytochrome c oxidase subunit 4 isoform 1, mitochondrial
9	9606.ENSP00000306397	0.998	Cytochrome b-c1 complex subunit Rieske, mitochondrial
10	9606.ENSP00000307786	0.998	Cytochrome c
11	9606.ENSP00000317159	0.998	Cytochrome c1, heme protein, mitochondrial
12	9606.ENSP00000354499	0.998	Cytochrome c oxidase subunit 1
13	9606.ENSP00000268379	0.997	Cytochrome b-c1 complex subunit 2, mitochondrial
14	9606.ENSP00000354982	0.997	Cytochrome c oxidase subunit 3
15	9606.ENSP00000430494	0.997	Cytochrome b-c1 complex subunit 7
16	9606.ENSP00000321260	0.995	Cytochrome c oxidase subunit 8A, mitochondrial
17	9606.ENSP00000339720	0.994	Cytochrome c oxidase subunit NDUFA4
18	9606.ENSP00000215375	0.992	ATP synthase subunit delta, mitochondrial
19	9606.ENSP00000332887	0.992	Cytochrome b-c1 complex subunit 9
20	9606.ENSP00000215565	0.990	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004129	1.000	cytochrome-c oxidase activity
GO:0005488	0.902	binding
GO:0005515	0.795	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.837	multicellular organismal process
GO:0007585	0.761	respiratory gaseous exchange by respiratory system
GO:0008152	0.397	metabolic process
GO:0009987	0.322	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0016020	0.998	membrane
GO:0032991	0.996	protein-containing complex
GO:0031090	0.990	organelle membrane
GO:0005740	0.976	mitochondrial envelope
GO:1902494	0.967	catalytic complex
GO:0005743	0.958	mitochondrial inner membrane
GO:0070469	0.938	respirasome
GO:0098800	0.925	inner mitochondrial membrane protein complex
GO:0005746	0.915	mitochondrial respirasome
GO:0098803	0.899	respiratory chain complex
GO:0070069	0.816	cytochrome complex
GO:0045277	0.676	respiratory chain complex IV
GO:0005751	0.552	mitochondrial respiratory chain complex IV

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:11436	1.000	4 Fe(II)-[cytochrome c] + 8 H(+)(in) + O2 = 4 Fe(III)-[cytochrome c] + 4 H(+)(out) + 2 H2O
EC:7.1.1.9	1.000	cytochrome-c oxidase.

[back to server]