StarFunc result for job id P10619

User Input

>input (480 residues)
MIRAAPPPLFLLLLLLLLLVSWASRGEAAPDQDEIQRLPGLAKQPSFRQYSGYLKGSGSK
HLHYWFVESQKDPENSPVVLWLNGGPGCSSLDGLLTEHGPFLVQPDGVTLEYNPYSWNLI
ANVLYLESPAGVGFSYSDDKFYATNDTEVAQSNFEALQDFFRLFPEYKNNKLFLTGESYA
GIYIPTLAVLVMQDPSMNLQGLAVGNGLSSYEQNDNSLVYFAYYHGLLGNRLWSSLQTHC
CSQNKCNFYDNKDLECVTNLQEVARIVGNSGLNIYNLYAPCAGGVPSHFRYEKDTVVVQD
LGNIFTRLPLKRMWHQALLRSGDKVRMDPPCTNTTAASTYLNNPYVRKALNIPEQLPQWD
MCNFLVNLQYRRLYRSMNSQYLKLLSSQKYQILLYNGDVDMACNFMGDEWFVDSLNQKME
VQRRPWLVKYGDSGEQIAGFVKEFSHIAFLTIKGAGHMVPTDKPLAAFTMFSRFLNKQPY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:X6R8A1	0.984	0.949	0.000	498	1.000	0.964	X6R8A1.pdb.gz	X6R8A1_HUMAN Carboxypeptidase OS=Homo sapiens OX=9606 GN=CTSA PE=1 SV=1
2	AFDB:P16675	0.955	0.967	3.985E-97	474	0.869	0.880	P16675.pdb.gz	PPGB_MOUSE Lysosomal protective protein OS=Mus musculus OX=10090 GN=Ctsa PE=1 SV=1
3	PDB:1ivyA	0.940	0.998	1.214E-96	452	0.940	0.998	1ivyA.pdb.gz
4	PDB:7kdvB	0.925	0.982	3.171E-87	452	0.835	0.887	7kdvB.pdb.gz
5	PDB:4ci9A	0.855	0.988	9.774E-87	415	0.858	0.993	4ci9A.pdb.gz
6	AFDB:Q6AYS3	0.871	0.916	2.818E-81	456	0.771	0.811	Q6AYS3.pdb.gz	Q6AYS3_RAT Carboxypeptidase OS=Rattus norvegicus OX=10116 GN=Ppgb PE=2 SV=1
7	AFDB:Q5JZH0	0.571	0.697	7.947E-55	392	0.600	0.735	Q5JZH0.pdb.gz	Q5JZH0_HUMAN Carboxypeptidase OS=Homo sapiens OX=9606 GN=CTSA PE=1 SV=3
8	AFDB:Q94269	0.796	0.174	3.428E-49	2314	0.392	0.081	Q94269.pdb.gz	Q94269_CAEEL Carboxypeptidase OS=Caenorhabditis elegans OX=6239 GN=ctsa-2 PE=1 SV=2
9	AFDB:Q8L7B2	0.820	0.793	2.893E-48	497	0.379	0.366	Q8L7B2.pdb.gz	SCP20_ARATH Serine carboxypeptidase-like 20 OS=Arabidopsis thaliana OX=3702 GN=SCPL20 PE=2 SV=2
10	AFDB:O76725	0.815	0.766	1.350E-47	512	0.325	0.305	O76725.pdb.gz	O76725_CAEEL Carboxypeptidase OS=Caenorhabditis elegans OX=6239 GN=ctsa-4.2 PE=1 SV=1
11	AFDB:K8ESM2	0.816	0.190	4.194E-46	2161	0.340	0.075	K8ESM2.pdb.gz	K8ESM2_CAEEL Carboxypeptidase OS=Caenorhabditis elegans OX=6239 GN=CELE_Y16B4A.2 PE=1 SV=1
12	AFDB:Q949Q7	0.754	0.756	2.337E-45	479	0.308	0.309	Q949Q7.pdb.gz	SCP29_ARATH Serine carboxypeptidase-like 29 OS=Arabidopsis thaliana OX=3702 GN=SCPL29 PE=2 SV=1
13	AFDB:Q9ZQQ0	0.763	0.808	3.539E-45	452	0.323	0.343	Q9ZQQ0.pdb.gz	SCP26_ARATH Serine carboxypeptidase-like 26 OS=Arabidopsis thaliana OX=3702 GN=SCPL26 PE=2 SV=1
14	PDB:6eicB	0.378	0.602	4.696E-8	279	0.100	0.172	6eicB.pdb.gz
15	PDB:1q0rA	0.353	0.535	6.701E-8	297	0.090	0.145	1q0rA.pdb.gz	Crystal structure of aclacinomycin methylesterase with bound product analogues: implications for anthracycline recognition and mechanism.
16	PDB:5jzsB	0.372	0.593	6.701E-8	284	0.115	0.194	5jzsB.pdb.gz	Investigation of the mycobacterial enzyme HsaD as a potential novel target for anti-tubercular agents using a fragment-based drug design approach.
17	PDB:2zjfA	0.365	0.485	1.630E-7	346	0.115	0.159	2zjfA.pdb.gz	The molecular structure of epoxide hydrolase B from Mycobacterium tuberculosis and its complex with a urea-based inhibitor.
18	PDB:1k8qA	0.365	0.451	3.963E-7	377	0.106	0.135	1k8qA.pdb.gz	Crystal structure of the open form of dog gastric lipase in complex with a phosphonate inhibitor.
19	PDB:3afiB	0.370	0.552	5.023E-7	302	0.121	0.192	3afiB.pdb.gz
20	PDB:4haiA	0.367	0.330	7.604E-7	548	0.123	0.108	4haiA.pdb.gz	Synthesis and structure-activity relationship of piperidine-derived non-urea soluble epoxide hydrolase inhibitors.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P10619	0.0	996	480	1.000	1.000	PPGB_HUMAN Lysosomal protective protein OS=Homo sapiens OX=9606 GN=CTSA PE=1 SV=2
2	P16675	0.0	858	474	0.850	0.861	PPGB_MOUSE Lysosomal protective protein OS=Mus musculus OX=10090 GN=Ctsa PE=1 SV=1
3	Q59EV6	0.0	991	497	0.998	0.964	Q59EV6_HUMAN Carboxypeptidase (Fragment) OS=Homo sapiens OX=9606 GN=PPGB PE=1 SV=1
4	Q5JZH0	0.0	598	392	0.604	0.740	Q5JZH0_HUMAN Carboxypeptidase OS=Homo sapiens OX=9606 GN=CTSA PE=1 SV=3
5	Q6AYS3	0.0	725	456	0.733	0.772	Q6AYS3_RAT Carboxypeptidase OS=Rattus norvegicus OX=10116 GN=Ppgb PE=2 SV=1
6	X6R5C5	0.0	951	481	0.965	0.963	X6R5C5_HUMAN Carboxypeptidase OS=Homo sapiens OX=9606 GN=CTSA PE=1 SV=1
7	X6R8A1	0.0	996	498	1.000	0.964	X6R8A1_HUMAN Carboxypeptidase OS=Homo sapiens OX=9606 GN=CTSA PE=1 SV=1
8	K8ESM2	2.10e-94	315	2161	0.421	0.093	K8ESM2_CAEEL Carboxypeptidase OS=Caenorhabditis elegans OX=6239 GN=CELE_Y16B4A.2 PE=1 SV=1
9	Q8L7B2	2.54e-93	293	497	0.379	0.366	SCP20_ARATH Serine carboxypeptidase-like 20 OS=Arabidopsis thaliana OX=3702 GN=SCPL20 PE=2 SV=2
10	Q94269	1.13e-89	301	2314	0.410	0.085	Q94269_CAEEL Carboxypeptidase OS=Caenorhabditis elegans OX=6239 GN=ctsa-2 PE=1 SV=2
11	O76725	4.88e-86	275	512	0.331	0.311	O76725_CAEEL Carboxypeptidase OS=Caenorhabditis elegans OX=6239 GN=ctsa-4.2 PE=1 SV=1
12	P52716	7.10e-86	276	574	0.388	0.324	CTS31_CAEEL Serine carboxypeptidase ctsa-3.1 OS=Caenorhabditis elegans OX=6239 GN=ctsa-3.1 PE=1 SV=1
13	U3KQ41	3.64e-72	225	109	0.227	1.000	U3KQ41_HUMAN Lysosomal protective protein (Fragment) OS=Homo sapiens OX=9606 GN=CTSA PE=1 SV=8
14	Q9ZQQ0	3.72e-68	226	452	0.315	0.334	SCP26_ARATH Serine carboxypeptidase-like 26 OS=Arabidopsis thaliana OX=3702 GN=SCPL26 PE=2 SV=1
15	Q949Q7	5.04e-64	216	479	0.298	0.299	SCP29_ARATH Serine carboxypeptidase-like 29 OS=Arabidopsis thaliana OX=3702 GN=SCPL29 PE=2 SV=1
16	A0A0C3VJP4	3.61e-63	214	495	0.317	0.307	SCP1_MEDTR Serine carboxypeptidase 1 OS=Medicago truncatula OX=3880 GN=SCP1 PE=1 SV=3
17	Q0WPR4	4.92e-60	206	499	0.321	0.309	SCP34_ARATH Serine carboxypeptidase-like 34 OS=Arabidopsis thaliana OX=3702 GN=SCPL34 PE=2 SV=2
18	Q9M099	3.80e-57	198	465	0.308	0.318	SCP24_ARATH Serine carboxypeptidase 24 OS=Arabidopsis thaliana OX=3702 GN=SCPL24 PE=1 SV=1
19	Q93Y09	8.12e-56	194	461	0.294	0.306	SCP45_ARATH Serine carboxypeptidase-like 45 OS=Arabidopsis thaliana OX=3702 GN=SCPL45 PE=2 SV=1
20	Q8VY01	8.87e-56	194	465	0.304	0.314	SCP46_ARATH Serine carboxypeptidase-like 46 OS=Arabidopsis thaliana OX=3702 GN=SCPL46 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00450 Peptidase_S10	6.8e-136	465.6	Serine carboxypeptidase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000361562

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000364782	0.993	Sialidase-1
2	9606.ENSP00000306920	0.974	Beta-galactosidase
3	9606.ENSP00000268695	0.961	N-acetylgalactosamine-6-sulfatase
4	9606.ENSP00000339398	0.906	Major histocompatibility complex, class II, DQ alpha 1
5	9606.ENSP00000009530	0.905	HLA class II histocompatibility antigen gamma chain
6	9606.ENSP00000378786	0.902	HLA class II histocompatibility antigen, DR alpha chain
7	9606.ENSP00000390431	0.902	Major histocompatibility complex, class II, DQ beta 2
8	9606.ENSP00000364080	0.901	HLA class II histocompatibility antigen, DQ beta 1 chain
9	9606.ENSP00000353099	0.900	HLA class II histocompatibility antigen, DRB1-15 beta chain
10	9606.ENSP00000364076	0.900	HLA class II histocompatibility antigen, DQ alpha 2 chain
11	9606.ENSP00000364114	0.900	HLA class II histocompatibility antigen, DR beta 5 chain
12	9606.ENSP00000393566	0.900	HLA class II histocompatibility antigen, DP alpha 1 chain
13	9606.ENSP00000408146	0.900	HLA class II histocompatibility antigen, DP beta 1 chain
14	9606.ENSP00000351807	0.891	Elastin
15	9606.ENSP00000236671	0.889	Cathepsin D
16	9606.ENSP00000320318	0.811	Sialidase-4
17	9606.ENSP00000353720	0.768	Liver carboxylesterase 1
18	9606.ENSP00000304229	0.749	Histidine triad nucleotide-binding protein 1
19	9606.ENSP00000345672	0.746	Cathepsin B
20	9606.ENSP00000350911	0.726	Cathepsin E

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.996	protein binding
GO:0016787	0.995	hydrolase activity
GO:0008233	0.990	peptidase activity
GO:0017171	0.988	serine hydrolase activity
GO:0004185	0.982	serine-type carboxypeptidase activity
GO:0098772	0.591	molecular function regulator activity
GO:0008047	0.579	enzyme activator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.980	organic substance metabolic process
GO:0009987	0.976	cellular process
GO:0050789	0.975	regulation of biological process
GO:0044238	0.970	primary metabolic process
GO:0060255	0.963	regulation of macromolecule metabolic process
GO:0006807	0.960	nitrogen compound metabolic process
GO:0048523	0.959	negative regulation of cellular process
GO:1901564	0.954	organonitrogen compound metabolic process
GO:0031647	0.948	regulation of protein stability
GO:0031330	0.911	negative regulation of cellular catabolic process
GO:0051246	0.895	regulation of protein metabolic process
GO:0043170	0.868	macromolecule metabolic process
GO:0042176	0.868	regulation of protein catabolic process
GO:0010506	0.833	regulation of autophagy
GO:0051248	0.817	negative regulation of protein metabolic process
GO:0019538	0.808	protein metabolic process
GO:0006508	0.785	proteolysis
GO:0042177	0.722	negative regulation of protein catabolic process
GO:0010507	0.352	negative regulation of autophagy

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	0.997	intracellular membrane-bounded organelle
GO:0005737	0.955	cytoplasm
GO:0012505	0.886	endomembrane system
GO:0043233	0.851	organelle lumen
GO:0031982	0.797	vesicle
GO:0070013	0.779	intracellular organelle lumen
GO:0016020	0.722	membrane
GO:0005773	0.688	vacuole
GO:0005576	0.678	extracellular region
GO:0005764	0.615	lysosome
GO:0005615	0.612	extracellular space
GO:0070062	0.559	extracellular exosome
GO:0030141	0.523	secretory granule
GO:0005775	0.458	vacuolar lumen
GO:0098588	0.363	bounding membrane of organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.995	Hydrolases.
EC:3.4.-.-	0.990	Acting on peptide bonds (peptidases).
EC:3.4.16.-	0.982	Serine-type carboxypeptidases.

[back to server]