StarFunc result for job id P10636

User Input

>input (758 residues)
MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKESPLQTPTEDGSEEPG
SETSDAKSTPTAEDVTAPLVDEGAPGKQAAAQPHTEIPEGTTAEEAGIGDTPSLEDEAAG
HVTQEPESGKVVQEGFLREPGPPGLSHQLMSGMPGAPLLPEGPREATRQPSGTGPEDTEG
GRHAPELLKHQLLGDLHQEGPPLKGAGGKERPGSKEEVDEDRDVDESSPQDSPPSKASPA
QDGRPPQTAAREATSIPGFPAEGAIPLPVDFLSKVSTEIPASEPDGPSVGRAKGQDAPLE
FTFHVEITPNVQKEQAHSEEHLGRAAFPGAPGEGPEARGPSLGEDTKEADLPEPSEKQPA
AAPRGKPVSRVPQLKARMVSKSKDGTGSDDKKAKTSTRSSAKTLKNRPCLSPKHPTPGSS
DPLIQPSSPAVCPEPPSSPKYVSSVTSRTGSSGAKEMKLKGADGKTKIATPRGAAPPGQK
GQANATRIPAKTPPAPKTPPSSGEPPKSGDRSGYSSPGSPGTPGSRSRTPSLPTPPTREP
KKVAVVRTPPKSPSSAKSRLQTAPVPMPDLKNVKSKIGSTENLKHQPGGGKVQIINKKLD
LSNVQSKCGSKDNIKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEK
LDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRENAKAKTDHGAEIVYKSPVVSGDT
SPRHLSNVSSTGSIDMVDSPQLATLADEVSASLAKQGL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R9Y1	0.102	0.102	1.654E-93	758	0.996	0.996	A0A024R9Y1.pdb.gz
2	AFDB:P19332	0.109	0.109	8.023E-69	752	0.761	0.767	P19332.pdb.gz	TAU_RAT Microtubule-associated protein tau OS=Rattus norvegicus OX=10116 GN=Mapt PE=1 SV=3
3	AFDB:P15146	0.096	0.055	3.099E-19	1861	0.328	0.134	P15146.pdb.gz	MTAP2_RAT Microtubule-associated protein 2 OS=Rattus norvegicus OX=10116 GN=Map2 PE=1 SV=3
4	AFDB:P11137	0.083	0.044	1.197E-12	1827	0.284	0.118	P11137.pdb.gz	MTAP2_HUMAN Microtubule-associated protein 2 OS=Homo sapiens OX=9606 GN=MAP2 PE=1 SV=4
5	AFDB:P20357	0.078	0.040	6.111E-12	1828	0.310	0.129	P20357.pdb.gz	MTAP2_MOUSE Microtubule-associated protein 2 OS=Mus musculus OX=10090 GN=Map2 PE=1 SV=2
6	AFDB:P27816	0.061	0.044	4.295E-10	1152	0.280	0.184	P27816.pdb.gz	MAP4_HUMAN Microtubule-associated protein 4 OS=Homo sapiens OX=9606 GN=MAP4 PE=1 SV=3
7	AFDB:P27546	0.054	0.040	1.772E-9	1125	0.281	0.189	P27546.pdb.gz	MAP4_MOUSE Microtubule-associated protein 4 OS=Mus musculus OX=10090 GN=Map4 PE=1 SV=3
8	AFDB:Q9VB15	0.057	0.059	2.526E-9	717	0.215	0.227	Q9VB15.pdb.gz	Q9VB15_DROME Microtubule-associated protein OS=Drosophila melanogaster OX=7227 GN=tau PE=1 SV=3
9	AFDB:Q5M7W5	0.043	0.036	4.796E-5	1057	0.239	0.171	Q5M7W5.pdb.gz	MAP4_RAT Microtubule-associated protein 4 OS=Rattus norvegicus OX=10116 GN=Map4 PE=1 SV=1
10	AFDB:Q583Y9	0.045	0.038	2.128E-2	933	0.175	0.143	Q583Y9.pdb.gz	Q583Y9_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.2H8.600 PE=4 SV=1
11	PDB:6rlbD	0.028	0.045	9.993	446	0.017	0.029	6rlbD.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P10636	0.0	1496	758	1.000	1.000	TAU_HUMAN Microtubule-associated protein tau OS=Homo sapiens OX=9606 GN=MAPT PE=1 SV=5
2	P10637	0.0	1016	733	0.751	0.776	TAU_MOUSE Microtubule-associated protein tau OS=Mus musculus OX=10090 GN=Mapt PE=1 SV=3
3	P19332	0.0	1050	752	0.766	0.773	TAU_RAT Microtubule-associated protein tau OS=Rattus norvegicus OX=10116 GN=Mapt PE=1 SV=3
4	P29172	0.0	561	448	0.384	0.650	TAU_BOVIN Microtubule-associated protein tau OS=Bos taurus OX=9913 GN=MAPT PE=1 SV=3
5	P15146	1.85e-93	322	1861	0.214	0.087	MTAP2_RAT Microtubule-associated protein 2 OS=Rattus norvegicus OX=10116 GN=Map2 PE=1 SV=3
6	F1MEW3	1.45e-92	320	2008	0.214	0.081	F1MEW3_BOVIN Microtubule-associated protein OS=Bos taurus OX=9913 GN=MAP2 PE=4 SV=2
7	P20357	1.21e-68	249	1828	0.182	0.075	MTAP2_MOUSE Microtubule-associated protein 2 OS=Mus musculus OX=10090 GN=Map2 PE=1 SV=2
8	P11137	4.57e-68	247	1827	0.182	0.076	MTAP2_HUMAN Microtubule-associated protein 2 OS=Homo sapiens OX=9606 GN=MAP2 PE=1 SV=4
9	P27546	9.68e-45	176	1125	0.121	0.082	MAP4_MOUSE Microtubule-associated protein 4 OS=Mus musculus OX=10090 GN=Map4 PE=1 SV=3
10	P27816	1.47e-44	175	1152	0.124	0.082	MAP4_HUMAN Microtubule-associated protein 4 OS=Homo sapiens OX=9606 GN=MAP4 PE=1 SV=3
11	Q5M7W5	1.48e-28	125	1057	0.087	0.062	MAP4_RAT Microtubule-associated protein 4 OS=Rattus norvegicus OX=10116 GN=Map4 PE=1 SV=1
12	A0A0B4LHV0	4.12e-28	116	278	0.108	0.295	A0A0B4LHV0_DROME Microtubule-associated protein OS=Drosophila melanogaster OX=7227 GN=tau PE=1 SV=1
13	Q9VB13	6.26e-28	118	361	0.108	0.227	Q9VB13_DROME Microtubule-associated protein OS=Drosophila melanogaster OX=7227 GN=tau PE=1 SV=2
14	A0A0B4KHQ8	1.26e-27	117	349	0.108	0.235	A0A0B4KHQ8_DROME Microtubule-associated protein OS=Drosophila melanogaster OX=7227 GN=tau PE=1 SV=1
15	A0A0B4LIS6	1.86e-27	117	403	0.108	0.203	A0A0B4LIS6_DROME Microtubule-associated protein OS=Drosophila melanogaster OX=7227 GN=tau PE=1 SV=1
16	A0A126GV16	3.55e-27	116	375	0.108	0.219	A0A126GV16_DROME Microtubule-associated protein OS=Drosophila melanogaster OX=7227 GN=tau PE=1 SV=1
17	Q9VB15	5.82e-27	119	717	0.108	0.114	Q9VB15_DROME Microtubule-associated protein OS=Drosophila melanogaster OX=7227 GN=tau PE=1 SV=3
18	A0A0B4LIT4	8.38e-26	112	367	0.108	0.223	A0A0B4LIT4_DROME Microtubule-associated protein OS=Drosophila melanogaster OX=7227 GN=tau PE=1 SV=1
19	A0A0B4KI45	8.29e-25	107	308	0.102	0.250	A0A0B4KI45_DROME Microtubule-associated protein OS=Drosophila melanogaster OX=7227 GN=tau PE=1 SV=1
20	A0A0B4LHS3	2.83e-24	107	350	0.102	0.220	A0A0B4LHS3_DROME Microtubule-associated protein OS=Drosophila melanogaster OX=7227 GN=tau PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10267 Tmemb_cc2	4.9e+02	11.3	Predicted transmembrane and coiled-coil 2 protein
2	PF00418 Tubulin-binding	4.3e-56	197.8	Tau and MAP protein, tubulin-binding repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000340820

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000324806	0.999	Glycogen synthase kinase-3 beta
2	9606.ENSP00000252486	0.997	Apolipoprotein E
3	9606.ENSP00000346671	0.997	Tyrosine-protein kinase Fyn
4	9606.ENSP00000419782	0.997	Cyclin-dependent-like kinase 5
5	9606.ENSP00000379287	0.993	14-3-3 protein zeta/delta
6	9606.ENSP00000385751	0.990	Serine/threonine-protein kinase MARK2
7	9606.ENSP00000291700	0.989	Protein S100-B
8	9606.ENSP00000311032	0.988	Caspase-3
9	9606.ENSP00000338345	0.988	Alpha-synuclein
10	9606.ENSP00000320295	0.987	Tubulin beta-3 chain
11	9606.ENSP00000418447	0.984	Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform
12	9606.ENSP00000381412	0.983	Calcium/calmodulin-dependent protein kinase type II subunit alpha
13	9606.ENSP00000221138	0.980	Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform
14	9606.ENSP00000432083	0.979	Heat shock cognate 71 kDa protein
15	9606.ENSP00000309591	0.977	cAMP-dependent protein kinase catalytic subunit alpha
16	9606.ENSP00000284981	0.969	Amyloid-beta A4 protein
17	9606.ENSP00000222330	0.967	Glycogen synthase kinase-3 alpha
18	9606.ENSP00000248437	0.967	Tubulin alpha-4A chain
19	9606.ENSP00000378974	0.967	Mitogen-activated protein kinase 8
20	9606.ENSP00000301071	0.958	Tubulin alpha-1A chain

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019901	1.000	protein kinase binding
GO:0008017	1.000	microtubule binding
GO:0051879	0.979	Hsp90 protein binding
GO:0051721	0.965	protein phosphatase 2A binding
GO:0051087	0.955	chaperone binding
GO:0044877	0.944	protein-containing complex binding
GO:0097159	0.930	organic cyclic compound binding
GO:1901363	0.926	heterocyclic compound binding
GO:0003676	0.897	nucleic acid binding
GO:0003677	0.537	DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.996	biological regulation
GO:0016043	0.991	cellular component organization
GO:0050794	0.987	regulation of cellular process
GO:0048518	0.987	positive regulation of biological process
GO:0006810	0.986	transport
GO:0060255	0.985	regulation of macromolecule metabolic process
GO:0048522	0.981	positive regulation of cellular process
GO:0007610	0.980	behavior
GO:0006996	0.978	organelle organization
GO:0007399	0.977	nervous system development
GO:0051128	0.976	regulation of cellular component organization
GO:0051246	0.975	regulation of protein metabolic process
GO:0050896	0.971	response to stimulus
GO:0030154	0.962	cell differentiation
GO:0065009	0.959	regulation of molecular function
GO:0007017	0.956	microtubule-based process
GO:0048583	0.956	regulation of response to stimulus
GO:0030705	0.951	cytoskeleton-dependent intracellular transport
GO:0099111	0.938	microtubule-based transport
GO:0065008	0.936	regulation of biological quality
GO:0010646	0.935	regulation of cell communication
GO:0032886	0.932	regulation of microtubule-based process
GO:0051640	0.929	organelle localization
GO:0023051	0.924	regulation of signaling
GO:0008152	0.887	metabolic process
GO:0006950	0.887	response to stress
GO:0051716	0.883	cellular response to stimulus
GO:0010970	0.869	transport along microtubule
GO:0048523	0.867	negative regulation of cellular process
GO:0051130	0.865	positive regulation of cellular component organization
GO:0043254	0.864	regulation of protein-containing complex assembly
GO:1902903	0.860	regulation of supramolecular fiber organization
GO:0031323	0.856	regulation of cellular metabolic process
GO:0051656	0.850	establishment of organelle localization
GO:0009893	0.848	positive regulation of metabolic process
GO:0033043	0.842	regulation of organelle organization
GO:0008088	0.835	axo-dendritic transport
GO:0047497	0.835	mitochondrion transport along microtubule
GO:0048468	0.812	cell development
GO:0022008	0.809	neurogenesis
GO:0031110	0.792	regulation of microtubule polymerization or depolymerization
GO:0032271	0.780	regulation of protein polymerization
GO:0042221	0.768	response to chemical
GO:0030030	0.768	cell projection organization
GO:0031113	0.760	regulation of microtubule polymerization
GO:0071704	0.759	organic substance metabolic process
GO:0120036	0.747	plasma membrane bounded cell projection organization
GO:0051495	0.719	positive regulation of cytoskeleton organization
GO:0031334	0.706	positive regulation of protein-containing complex assembly
GO:0000226	0.701	microtubule cytoskeleton organization
GO:1902905	0.701	positive regulation of supramolecular fiber organization
GO:0048699	0.682	generation of neurons
GO:0044238	0.676	primary metabolic process
GO:0030182	0.672	neuron differentiation
GO:0032879	0.665	regulation of localization
GO:0006807	0.643	nitrogen compound metabolic process
GO:0032273	0.643	positive regulation of protein polymerization
GO:0007154	0.637	cell communication
GO:0010604	0.626	positive regulation of macromolecule metabolic process
GO:0023052	0.625	signaling
GO:0044237	0.616	cellular metabolic process
GO:0098930	0.595	axonal transport
GO:0031112	0.595	positive regulation of microtubule polymerization or depolymerization
GO:0031399	0.567	regulation of protein modification process
GO:0043170	0.566	macromolecule metabolic process
GO:0060341	0.537	regulation of cellular localization
GO:0050790	0.527	regulation of catalytic activity
GO:0031116	0.523	positive regulation of microtubule polymerization
GO:1901564	0.510	organonitrogen compound metabolic process
GO:0044085	0.506	cellular component biogenesis
GO:0051174	0.470	regulation of phosphorus metabolic process
GO:0007165	0.465	signal transduction
GO:0051173	0.452	positive regulation of nitrogen compound metabolic process
GO:0010605	0.444	negative regulation of macromolecule metabolic process
GO:0019538	0.440	protein metabolic process
GO:0051248	0.419	negative regulation of protein metabolic process
GO:0031325	0.412	positive regulation of cellular metabolic process
GO:0080135	0.394	regulation of cellular response to stress
GO:0031175	0.386	neuron projection development
GO:0044093	0.385	positive regulation of molecular function
GO:0022607	0.361	cellular component assembly
GO:0070887	0.348	cellular response to chemical stimulus
GO:0051247	0.347	positive regulation of protein metabolic process
GO:0010468	0.341	regulation of gene expression
GO:0019220	0.332	regulation of phosphate metabolic process
GO:0043085	0.323	positive regulation of catalytic activity
GO:0010941	0.319	regulation of cell death
GO:0120035	0.305	regulation of plasma membrane bounded cell projection organization
GO:0051239	0.300	regulation of multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005634	0.998	nucleus
GO:0005886	0.996	plasma membrane
GO:0070013	0.995	intracellular organelle lumen
GO:0043232	0.994	intracellular non-membrane-bounded organelle
GO:0005654	0.992	nucleoplasm
GO:0005829	0.988	cytosol
GO:0042995	0.933	cell projection
GO:0043005	0.921	neuron projection
GO:0030424	0.901	axon
GO:0005856	0.714	cytoskeleton
GO:0032991	0.625	protein-containing complex
GO:0015630	0.603	microtubule cytoskeleton
GO:0036477	0.574	somatodendritic compartment
GO:0016604	0.521	nuclear body
GO:0045202	0.501	synapse
GO:0099080	0.474	supramolecular complex
GO:0097447	0.435	dendritic tree
GO:0030425	0.417	dendrite
GO:0044297	0.338	cell body
GO:0043025	0.309	neuronal cell body

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]