StarFunc result for job id P10644

User Input

>input (381 residues)
MESGSTAASEEARSLRECELYVQKHNIQALLKDSIVQLCTARPERPMAFLREYFERLEKE
EAKQIQNLQKAGTRTDSREDEISPPPPNPVVKGRRRRGAISAEVYTEEDAASYVRKVIPK
DYKTMAALAKAIEKNVLFSHLDDNERSDIFDAMFSVSFIAGETVIQQGDEGDNFYVIDQG
ETDVYVNNEWATSVGEGGSFGELALIYGTPRAATVKAKTNVKLWGIDRDSYRRILMGSTL
RKRKMYEEFLSKVSILESLDKWERLTVADALEPVQFEDGQKIVVQGEPGDEFFIILEGSA
AVLQRRSENEEFVEVGRLGPSDYFGEIALLMNRPRAATVVARGPLKCVKLDRPRFERVLG
PCSDILKRNIQQYNSFVSLSV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P09456	0.939	0.939	2.745E-71	381	0.974	0.974	P09456.pdb.gz	KAP0_RAT cAMP-dependent protein kinase type I-alpha regulatory subunit OS=Rattus norvegicus OX=10116 GN=Prkar1a PE=1 SV=2
2	AFDB:P12849	0.763	0.763	1.899E-63	381	0.806	0.806	P12849.pdb.gz	KAP1_MOUSE cAMP-dependent protein kinase type I-beta regulatory subunit OS=Mus musculus OX=10090 GN=Prkar1b PE=1 SV=2
3	AFDB:P16905	0.842	0.853	4.055E-61	376	0.709	0.718	P16905.pdb.gz	KAPR1_DROME cAMP-dependent protein kinase type I regulatory subunit OS=Drosophila melanogaster OX=7227 GN=Pka-R1 PE=1 SV=2
4	PDB:6byrB	0.621	0.795	1.534E-52	288	0.751	0.993	6byrB.pdb.gz	Structures of the PKA RI alpha Holoenzyme with the FLHCC Driver J-PKAc alpha or Wild-Type PKAc alpha.
5	AFDB:P30625	0.733	0.760	3.364E-51	366	0.559	0.582	P30625.pdb.gz	KAPR_CAEEL cAMP-dependent protein kinase regulatory subunit OS=Caenorhabditis elegans OX=6239 GN=kin-2 PE=1 SV=3
6	PDB:4dinB	0.650	0.709	2.084E-48	345	0.722	0.797	4dinB.pdb.gz	Localization and quaternary structure of the PKA RI Beta holoenzyme
7	AFDB:P05987	0.708	0.819	4.947E-42	327	0.409	0.477	P05987.pdb.gz	KAPR_DICDI cAMP-dependent protein kinase regulatory subunit OS=Dictyostelium discoideum OX=44689 GN=pkaR PE=1 SV=1
8	AFDB:A9C3T0	0.739	0.711	2.001E-38	397	0.354	0.340	A9C3T0.pdb.gz	A9C3T0_DANRE Protein kinase, cAMP-dependent, regulatory, type II, alpha A OS=Danio rerio OX=7955 GN=wu:fb55f12 PE=1 SV=1
9	AFDB:P31322	0.716	0.657	2.531E-37	418	0.381	0.347	P31322.pdb.gz	KAP3_BOVIN cAMP-dependent protein kinase type II-beta regulatory subunit OS=Bos taurus OX=9913 GN=PRKAR2B PE=2 SV=2
10	AFDB:P07278	0.685	0.629	3.790E-37	416	0.318	0.291	P07278.pdb.gz	KAPR_YEAST cAMP-dependent protein kinase regulatory subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BCY1 PE=1 SV=4
11	AFDB:P13861	0.711	0.674	7.147E-37	404	0.365	0.344	P13861.pdb.gz	KAP2_HUMAN cAMP-dependent protein kinase type II-alpha regulatory subunit OS=Homo sapiens OX=9606 GN=PRKAR2A PE=1 SV=2
12	AFDB:P81900	0.697	0.703	7.572E-37	377	0.357	0.361	P81900.pdb.gz	KAPR2_DROME cAMP-dependent protein kinase type II regulatory subunit OS=Drosophila melanogaster OX=7227 GN=Pka-R2 PE=1 SV=2
13	PDB:3j4qB	0.650	0.649	1.974E-34	382	0.349	0.348	3j4qB.pdb.gz
14	PDB:5dykA	0.536	0.270	9.662E-27	809	0.239	0.112	5dykA.pdb.gz
15	PDB:6wjfC	0.593	0.744	3.857E-26	295	0.312	0.403	6wjfC.pdb.gz
16	PDB:2byvE	0.254	0.110	1.206E-15	922	0.184	0.076	2byvE.pdb.gz
17	PDB:4f7zA	0.258	0.112	2.409E-15	946	0.173	0.070	4f7zA.pdb.gz
18	PDB:3i54D	0.316	0.509	2.451E-11	228	0.087	0.145	3i54D.pdb.gz	Structural Insights into the Mechanism of the Allosteric Transitions of Mycobacterium tuberculosis cAMP Receptor Protein.
19	PDB:4byyA	0.326	0.535	3.101E-10	226	0.081	0.137	4byyA.pdb.gz
20	PDB:4avaA	0.254	0.293	9.828E-10	327	0.087	0.101	4avaA.pdb.gz	Cyclic AMP Regulation of Protein Lysine Acetylation in Mycobacterium Tuberculosis.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P00514	0.0	760	380	0.976	0.979	KAP0_BOVIN cAMP-dependent protein kinase type I-alpha regulatory subunit OS=Bos taurus OX=9913 GN=PRKAR1A PE=1 SV=2
2	P07802	0.0	757	380	0.976	0.979	KAP0_PIG cAMP-dependent protein kinase type I-alpha regulatory subunit OS=Sus scrofa OX=9823 GN=PRKAR1A PE=1 SV=2
3	P09456	0.0	762	381	0.974	0.974	KAP0_RAT cAMP-dependent protein kinase type I-alpha regulatory subunit OS=Rattus norvegicus OX=10116 GN=Prkar1a PE=1 SV=2
4	P10644	0.0	781	381	1.000	1.000	KAP0_HUMAN cAMP-dependent protein kinase type I-alpha regulatory subunit OS=Homo sapiens OX=9606 GN=PRKAR1A PE=1 SV=1
5	P12849	0.0	653	381	0.814	0.814	KAP1_MOUSE cAMP-dependent protein kinase type I-beta regulatory subunit OS=Mus musculus OX=10090 GN=Prkar1b PE=1 SV=2
6	P16905	0.0	551	376	0.711	0.721	KAPR1_DROME cAMP-dependent protein kinase type I regulatory subunit OS=Drosophila melanogaster OX=7227 GN=Pka-R1 PE=1 SV=2
7	P31321	0.0	655	381	0.814	0.814	KAP1_HUMAN cAMP-dependent protein kinase type I-beta regulatory subunit OS=Homo sapiens OX=9606 GN=PRKAR1B PE=1 SV=4
8	P81377	0.0	652	381	0.814	0.814	KAP1_RAT cAMP-dependent protein kinase type I-beta regulatory subunit OS=Rattus norvegicus OX=10116 GN=Prkar1b PE=2 SV=2
9	Q9DBC7	0.0	757	381	0.969	0.969	KAP0_MOUSE cAMP-dependent protein kinase type I-alpha regulatory subunit OS=Mus musculus OX=10090 GN=Prkar1a PE=1 SV=3
10	P30625	4.08e-148	425	366	0.562	0.585	KAPR_CAEEL cAMP-dependent protein kinase regulatory subunit OS=Caenorhabditis elegans OX=6239 GN=kin-2 PE=1 SV=3
11	P05987	1.13e-102	308	327	0.407	0.474	KAPR_DICDI cAMP-dependent protein kinase regulatory subunit OS=Dictyostelium discoideum OX=44689 GN=pkaR PE=1 SV=1
12	P81900	1.12e-78	248	377	0.357	0.361	KAPR2_DROME cAMP-dependent protein kinase type II regulatory subunit OS=Drosophila melanogaster OX=7227 GN=Pka-R2 PE=1 SV=2
13	P13861	3.83e-75	240	404	0.381	0.359	KAP2_HUMAN cAMP-dependent protein kinase type II-alpha regulatory subunit OS=Homo sapiens OX=9606 GN=PRKAR2A PE=1 SV=2
14	P00515	6.49e-75	239	401	0.386	0.367	KAP2_BOVIN cAMP-dependent protein kinase type II-alpha regulatory subunit OS=Bos taurus OX=9913 GN=PRKAR2A PE=1 SV=2
15	C1PIG4	2.18e-74	238	401	0.373	0.354	C1PIG4_PIG cAMP-dependent protein kinase regulatory subunit type II alpha OS=Sus scrofa OX=9823 GN=PRKAR2A PE=2 SV=1
16	P31322	8.69e-74	237	418	0.346	0.316	KAP3_BOVIN cAMP-dependent protein kinase type II-beta regulatory subunit OS=Bos taurus OX=9913 GN=PRKAR2B PE=2 SV=2
17	Q6DHZ2	1.28e-73	236	418	0.346	0.316	Q6DHZ2_HUMAN Protein kinase, cAMP-dependent, regulatory, type II, beta OS=Homo sapiens OX=9606 GN=PRKAR2B PE=1 SV=1
18	P31323	1.58e-73	236	418	0.346	0.316	KAP3_HUMAN cAMP-dependent protein kinase type II-beta regulatory subunit OS=Homo sapiens OX=9606 GN=PRKAR2B PE=1 SV=3
19	P31324	5.31e-73	235	416	0.346	0.317	KAP3_MOUSE cAMP-dependent protein kinase type II-beta regulatory subunit OS=Mus musculus OX=10090 GN=Prkar2b PE=1 SV=3
20	P12369	1.29e-72	234	416	0.339	0.310	KAP3_RAT cAMP-dependent protein kinase type II-beta regulatory subunit OS=Rattus norvegicus OX=10116 GN=Prkar2b PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00027 cNMP_binding	3.7e-38	140.8	Cyclic nucleotide-binding domain
2	PF02197 RIIa	1.5e-12	58.2	Regulatory subunit of type II PKA R-subunit

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000002549

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000016255	0.999	Protein kinase, cAMP-dependent, catalytic, alpha
2	61853.ENSNLEP00000012062	0.998	Belongs to the protein kinase superfamily.
3	61853.ENSNLEP00000008151	0.986	Protein kinase, cAMP-dependent, regulatory, type II, alpha
4	61853.ENSNLEP00000010733	0.984	Protein kinase, cAMP-dependent, regulatory, type II, beta
5	61853.ENSNLEP00000016166	0.930	A kinase (PRKA) anchor protein 10
6	61853.ENSNLEP00000010408	0.921	Belongs to the protein kinase superfamily.
7	61853.ENSNLEP00000009828	0.913	A kinase (PRKA) anchor protein 1
8	61853.ENSNLEP00000000188	0.909	Protein kinase, AMP-activated, beta 2 non-catalytic subunit
9	61853.ENSNLEP00000018679	0.904	annotation not available
10	61853.ENSNLEP00000010077	0.903	Protein kinase, cAMP-dependent, regulatory, type I, beta
11	61853.ENSNLEP00000020019	0.875	Protein kinase, AMP-activated, alpha 1 catalytic subunit
12	61853.ENSNLEP00000021687	0.868	Protein kinase, AMP-activated, gamma 1 non-catalytic subunit
13	61853.ENSNLEP00000011561	0.838	GNAS complex locus
14	61853.ENSNLEP00000013027	0.808	Lipase, hormone-sensitive
15	61853.ENSNLEP00000018127	0.806	Belongs to the G-protein coupled receptor 1 family.
16	61853.ENSNLEP00000008684	0.788	cAMP responsive element binding protein 1
17	61853.ENSNLEP00000017863	0.762	Protein kinase, AMP-activated, alpha 2 catalytic subunit
18	61853.ENSNLEP00000000281	0.760	Protein kinase, AMP-activated, beta 1 non-catalytic subunit
19	61853.ENSNLEP00000022048	0.750	cAMP responsive element modulator
20	61853.ENSNLEP00000005558	0.746	Protein kinase, AMP-activated, gamma 2 non-catalytic subunit

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008603	0.998	cAMP-dependent protein kinase regulator activity
GO:0034236	0.998	protein kinase A catalytic subunit binding
GO:0097159	0.932	organic cyclic compound binding
GO:1901363	0.931	heterocyclic compound binding
GO:0097367	0.880	carbohydrate derivative binding
GO:0017076	0.875	purine nucleotide binding
GO:0032553	0.872	ribonucleotide binding
GO:0043167	0.865	ion binding
GO:0032555	0.862	purine ribonucleotide binding
GO:0030291	0.745	protein serine/threonine kinase inhibitor activity
GO:0043168	0.724	anion binding
GO:0004862	0.678	cAMP-dependent protein kinase inhibitor activity
GO:0030551	0.581	cyclic nucleotide binding
GO:0030554	0.575	adenyl nucleotide binding
GO:0030552	0.558	cAMP binding
GO:0003824	0.325	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.992	regulation of cellular process
GO:0009987	0.983	cellular process
GO:0051174	0.977	regulation of phosphorus metabolic process
GO:0080090	0.974	regulation of primary metabolic process
GO:0051338	0.971	regulation of transferase activity
GO:0051171	0.971	regulation of nitrogen compound metabolic process
GO:0031399	0.961	regulation of protein modification process
GO:0019220	0.937	regulation of phosphate metabolic process
GO:0050896	0.896	response to stimulus
GO:0001932	0.894	regulation of protein phosphorylation
GO:0048523	0.887	negative regulation of cellular process
GO:0031400	0.873	negative regulation of protein modification process
GO:0045936	0.871	negative regulation of phosphate metabolic process
GO:0006469	0.862	negative regulation of protein kinase activity
GO:0032501	0.861	multicellular organismal process
GO:0032502	0.826	developmental process
GO:0051716	0.817	cellular response to stimulus
GO:0007154	0.752	cell communication
GO:0008152	0.745	metabolic process
GO:0007165	0.723	signal transduction
GO:0071704	0.704	organic substance metabolic process
GO:0048518	0.702	positive regulation of biological process
GO:0010646	0.672	regulation of cell communication
GO:0023051	0.671	regulation of signaling
GO:0006807	0.590	nitrogen compound metabolic process
GO:0044238	0.577	primary metabolic process
GO:0044237	0.567	cellular metabolic process
GO:0048522	0.544	positive regulation of cellular process
GO:0048583	0.441	regulation of response to stimulus
GO:0051726	0.429	regulation of cell cycle
GO:0071840	0.370	cellular component organization or biogenesis
GO:2000241	0.347	regulation of reproductive process
GO:0048856	0.335	anatomical structure development
GO:0043170	0.332	macromolecule metabolic process
GO:0016043	0.325	cellular component organization
GO:1901564	0.322	organonitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0032991	0.997	protein-containing complex
GO:1902494	0.987	catalytic complex
GO:1990234	0.979	transferase complex
GO:0140535	0.976	intracellular protein-containing complex
GO:0061695	0.972	transferase complex, transferring phosphorus-containing groups
GO:1902554	0.958	serine/threonine protein kinase complex
GO:0005829	0.955	cytosol
GO:0005952	0.951	cAMP-dependent protein kinase complex
GO:0043226	0.915	organelle
GO:0043227	0.909	membrane-bounded organelle
GO:0043229	0.877	intracellular organelle
GO:0016020	0.867	membrane
GO:0043231	0.797	intracellular membrane-bounded organelle
GO:0042995	0.420	cell projection

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]