StarFunc result for job id P10721

User Input

>input (976 residues)
MRGARGAWDFLCVLLLLLRVQTGSSQPSVSPGEPSPPSIHPGKSDLIVRVGDEIRLLCTD
PGFVKWTFEILDETNENKQNEWITEKAEATNTGKYTCTNKHGLSNSIYVFVRDPAKLFLV
DRSLYGKEDNDTLVRCPLTDPEVTNYSLKGCQGKPLPKDLRFIPDPKAGIMIKSVKRAYH
RLCLHCSVDQEGKSVLSEKFILKVRPAFKAVPVVSVSKASYLLREGEEFTVTCTIKDVSS
SVYSTWKRENSQTKLQEKYNSWHHGDFNYERQATLTISSARVNDSGVFMCYANNTFGSAN
VTTTLEVVDKGFINIFPMINTTVFVNDGENVDLIVEYEAFPKPEHQQWIYMNRTFTDKWE
DYPKSENESNIRYVSELHLTRLKGTEGGTYTFLVSNSDVNAAIAFNVYVNTKPEILTYDR
LVNGMLQCVAAGFPEPTIDWYFCPGTEQRCSASVLPVDVQTLNSSGPPFGKLVVQSSIDS
SAFKHNGTVECKAYNDVGKTSAYFNFAFKGNNKEQIHPHTLFTPLLIGFVIVAGMMCIIV
MILTYKYLQKPMYEVQWKVVEEINGNNYVYIDPTQLPYDHKWEFPRNRLSFGKTLGAGAF
GKVVEATAYGLIKSDAAMTVAVKMLKPSAHLTEREALMSELKVLSYLGNHMNIVNLLGAC
TIGGPTLVITEYCCYGDLLNFLRRKRDSFICSKQEDHAEAALYKNLLHSKESSCSDSTNE
YMDMKPGVSYVVPTKADKRRSVRIGSYIERDVTPAIMEDDELALDLEDLLSFSYQVAKGM
AFLASKNCIHRDLAARNILLTHGRITKICDFGLARDIKNDSNYVVKGNARLPVKWMAPES
IFNCVYTFESDVWSYGIFLWELFSLGSSPYPGMPVDSKFYKMIKEGFRMLSPEHAPAEMY
DIMKTCWDADPLKRPTFKQIVQLIEKQISESTNHIYSNLANCSPNRQKPVVDHSVRINSV
GSTASSSQPLLVHDDV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B8A5K6	0.467	0.476	0.000	957	0.461	0.470	B8A5K6.pdb.gz	B8A5K6_DANRE Mast/stem cell growth factor receptor OS=Danio rerio OX=7955 GN=kitb PE=3 SV=1
2	AFDB:P05532	0.689	0.687	0.000	979	0.828	0.825	P05532.pdb.gz	KIT_MOUSE Mast/stem cell growth factor receptor Kit OS=Mus musculus OX=10090 GN=Kit PE=1 SV=3
3	AFDB:P10721	1.000	1.000	0.000	976	1.000	1.000	P10721.pdb.gz	KIT_HUMAN Mast/stem cell growth factor receptor Kit OS=Homo sapiens OX=9606 GN=KIT PE=1 SV=1
4	AFDB:Q8JFR5	0.420	0.420	0.000	976	0.486	0.486	Q8JFR5.pdb.gz	KITA_DANRE Mast/stem cell growth factor receptor kita OS=Danio rerio OX=7955 GN=kita PE=2 SV=2
5	AFDB:Q9I8N6	0.482	0.482	4.315E-92	977	0.404	0.403	Q9I8N6.pdb.gz	CSF1R_DANRE Macrophage colony-stimulating factor 1 receptor OS=Danio rerio OX=7955 GN=csf1r PE=2 SV=1
6	AFDB:F1QPE2	0.413	0.425	2.157E-91	943	0.367	0.380	F1QPE2.pdb.gz
7	AFDB:Q00495	0.349	0.348	5.610E-91	978	0.387	0.387	Q00495.pdb.gz	CSF1R_RAT Macrophage colony-stimulating factor 1 receptor OS=Rattus norvegicus OX=10116 GN=Csf1r PE=1 SV=1
8	AFDB:P07333	0.405	0.405	7.670E-90	972	0.398	0.399	P07333.pdb.gz	CSF1R_HUMAN Macrophage colony-stimulating factor 1 receptor OS=Homo sapiens OX=9606 GN=CSF1R PE=1 SV=2
9	AFDB:P16234	0.374	0.340	2.996E-84	1089	0.348	0.312	P16234.pdb.gz	PGFRA_HUMAN Platelet-derived growth factor receptor alpha OS=Homo sapiens OX=9606 GN=PDGFRA PE=1 SV=1
10	AFDB:Q9PUF6	0.371	0.334	1.002E-83	1087	0.343	0.308	Q9PUF6.pdb.gz	PGFRA_CHICK Platelet-derived growth factor receptor alpha OS=Gallus gallus OX=9031 GN=PDGFRA PE=2 SV=1
11	PDB:1k9aB	0.236	0.508	9.445E-19	441	0.101	0.224	1k9aB.pdb.gz
12	PDB:4fl2A	0.249	0.424	5.775E-18	555	0.098	0.173	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
13	PDB:2h8hA	0.242	0.505	1.428E-17	445	0.120	0.263	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
14	PDB:4k2rA	0.241	0.418	7.219E-16	551	0.092	0.163	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
15	PDB:6dldD	0.157	0.492	3.796E-15	269	0.053	0.193	6dldD.pdb.gz
16	PDB:5oj2B	0.122	0.159	6.941E-15	692	0.086	0.121	5oj2B.pdb.gz
17	PDB:2rcjC	0.156	0.217	8.487E-15	523	0.080	0.149	2rcjC.pdb.gz
18	PDB:1e07A	0.153	0.203	3.649E-14	642	0.079	0.120	1e07A.pdb.gz
19	PDB:6s73A	0.239	0.793	2.122E-13	269	0.064	0.230	6s73A.pdb.gz	Nek7 conformational flexibility and inhibitor binding probed through protein engineering of the R-spine.
20	PDB:1igtB	0.102	0.183	2.623E-12	444	0.067	0.146	1igtB.pdb.gz	Refined structure of an intact IgG2a monoclonal antibody.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JTL4	0.0	1649	970	0.821	0.826	A0A0G2JTL4_RAT Mast/stem cell growth factor receptor OS=Rattus norvegicus OX=10116 GN=Kit PE=1 SV=2
2	B8A5K6	0.0	837	957	0.461	0.470	B8A5K6_DANRE Mast/stem cell growth factor receptor OS=Danio rerio OX=7955 GN=kitb PE=3 SV=1
3	P05532	0.0	1651	979	0.828	0.825	KIT_MOUSE Mast/stem cell growth factor receptor Kit OS=Mus musculus OX=10090 GN=Kit PE=1 SV=3
4	P07333	0.0	664	972	0.403	0.404	CSF1R_HUMAN Macrophage colony-stimulating factor 1 receptor OS=Homo sapiens OX=9606 GN=CSF1R PE=1 SV=2
5	P09581	0.0	660	977	0.398	0.397	CSF1R_MOUSE Macrophage colony-stimulating factor 1 receptor OS=Mus musculus OX=10090 GN=Csf1r PE=1 SV=3
6	P10721	0.0	2041	976	1.000	1.000	KIT_HUMAN Mast/stem cell growth factor receptor Kit OS=Homo sapiens OX=9606 GN=KIT PE=1 SV=1
7	Q00495	0.0	653	978	0.395	0.395	CSF1R_RAT Macrophage colony-stimulating factor 1 receptor OS=Rattus norvegicus OX=10116 GN=Csf1r PE=1 SV=1
8	Q63116	0.0	1674	978	0.840	0.838	Q63116_RAT Mast/stem cell growth factor receptor OS=Rattus norvegicus OX=10116 GN=Kit PE=1 SV=1
9	Q8JFR5	0.0	887	976	0.493	0.493	KITA_DANRE Mast/stem cell growth factor receptor kita OS=Danio rerio OX=7955 GN=kita PE=2 SV=2
10	Q9I8N6	0.0	659	977	0.388	0.388	CSF1R_DANRE Macrophage colony-stimulating factor 1 receptor OS=Danio rerio OX=7955 GN=csf1r PE=2 SV=1
11	P26618	4.81e-174	538	1089	0.363	0.325	PGFRA_MOUSE Platelet-derived growth factor receptor alpha OS=Mus musculus OX=10090 GN=Pdgfra PE=1 SV=3
12	P20786	7.15e-172	532	1088	0.360	0.323	PGFRA_RAT Platelet-derived growth factor receptor alpha OS=Rattus norvegicus OX=10116 GN=Pdgfra PE=1 SV=2
13	P16234	7.19e-169	524	1089	0.360	0.322	PGFRA_HUMAN Platelet-derived growth factor receptor alpha OS=Homo sapiens OX=9606 GN=PDGFRA PE=1 SV=1
14	Q9PUF6	8.44e-169	524	1087	0.350	0.315	PGFRA_CHICK Platelet-derived growth factor receptor alpha OS=Gallus gallus OX=9031 GN=PDGFRA PE=2 SV=1
15	Q9DE49	2.43e-161	504	1059	0.344	0.317	PGFRA_DANRE Platelet-derived growth factor receptor alpha OS=Danio rerio OX=7955 GN=pdgfra PE=2 SV=1
16	P09619	5.87e-158	496	1106	0.343	0.303	PGFRB_HUMAN Platelet-derived growth factor receptor beta OS=Homo sapiens OX=9606 GN=PDGFRB PE=1 SV=1
17	P05622	2.23e-157	494	1098	0.340	0.302	PGFRB_MOUSE Platelet-derived growth factor receptor beta OS=Mus musculus OX=10090 GN=Pdgfrb PE=1 SV=2
18	Q05030	2.81e-157	494	1097	0.345	0.307	PGFRB_RAT Platelet-derived growth factor receptor beta OS=Rattus norvegicus OX=10116 GN=Pdgfrb PE=2 SV=2
19	D9MNA7	5.43e-147	466	1064	0.328	0.301	D9MNA7_DANRE receptor protein-tyrosine kinase OS=Danio rerio OX=7955 GN=pdgfrb2 PE=2 SV=1
20	P36888	2.63e-145	459	993	0.311	0.306	FLT3_HUMAN Receptor-type tyrosine-protein kinase FLT3 OS=Homo sapiens OX=9606 GN=FLT3 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01636 APH	3.4e+02	12.4	Phosphotransferase enzyme family
2	PF18651 CshA_NR2	2	19.8	Surface adhesin CshA non-repetitive domain 2
3	PF07679 I-set	8.7e-12	56.3	Immunoglobulin I-set domain
4	PF00047 ig	1.6e-15	68.4	Immunoglobulin domain
5	PF13895 Ig_2	1.1e-08	46.6	Immunoglobulin domain
6	PF13927 Ig_3	2e-23	94.1	Immunoglobulin domain
7	PF16680 Ig_4	8.1	18.4	T-cell surface glycoprotein CD3 delta chain
8	PF16681 Ig_5	15	17.4	Ig-like domain on T-cell surface glycoprotein CD3 epsilon chain
9	PF18452 Ig_6	5.8e+02	11.7	Immunoglobulin domain
10	PF00069 Pkinase	2.2e-39	147.0	Protein kinase domain
11	PF17667 Pkinase_fungal	1.3e+02	12.8	Fungal protein kinase
12	PF07714 PK_Tyr_Ser-Thr	1.8e-99	343.8	Protein tyrosine and serine/threonine kinase
13	PF07686 V-set	22	16.6	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000288135

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000228280	0.999	Kit ligand
2	9606.ENSP00000376345	0.999	Growth factor receptor-bound protein 2
3	9606.ENSP00000345492	0.998	SH2B adapter protein 3
4	9606.ENSP00000428056	0.997	Phosphatidylinositol 3-kinase regulatory subunit alpha
5	9606.ENSP00000222139	0.996	Erythropoietin receptor
6	9606.ENSP00000340944	0.990	Tyrosine-protein phosphatase non-receptor type 11
7	9606.ENSP00000391592	0.981	Tyrosine-protein phosphatase non-receptor type 6
8	9606.ENSP00000407586	0.981	GTPase HRas
9	9606.ENSP00000264033	0.978	E3 ubiquitin-protein ligase CBL
10	9606.ENSP00000358548	0.978	GTPase NRas
11	9606.ENSP00000263967	0.977	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform
12	9606.ENSP00000428924	0.974	Tyrosine-protein kinase Lyn
13	9606.ENSP00000378485	0.970	Megakaryocyte-associated tyrosine-protein kinase
14	9606.ENSP00000222254	0.969	Phosphatidylinositol 3-kinase regulatory subunit beta
15	9606.ENSP00000256078	0.969	GTPase KRas
16	9606.ENSP00000329418	0.969	Suppressor of cytokine signaling 1
17	9606.ENSP00000354952	0.969	GRB2-associated-binding protein 2
18	9606.ENSP00000252723	0.968	Erythropoietin
19	9606.ENSP00000370912	0.966	Tyrosine-protein kinase Tec
20	9606.ENSP00000371067	0.965	Tyrosine-protein kinase JAK2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004714	0.996	transmembrane receptor protein tyrosine kinase activity
GO:0042802	0.907	identical protein binding
GO:0046983	0.904	protein dimerization activity
GO:0019955	0.902	cytokine binding
GO:0042803	0.331	protein homodimerization activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.993	response to stimulus
GO:0019222	0.989	regulation of metabolic process
GO:0048522	0.987	positive regulation of cellular process
GO:0009987	0.986	cellular process
GO:0048583	0.986	regulation of response to stimulus
GO:0023051	0.980	regulation of signaling
GO:0010646	0.980	regulation of cell communication
GO:0051716	0.978	cellular response to stimulus
GO:0080090	0.977	regulation of primary metabolic process
GO:0048584	0.958	positive regulation of response to stimulus
GO:0031323	0.958	regulation of cellular metabolic process
GO:0032501	0.951	multicellular organismal process
GO:0051240	0.951	positive regulation of multicellular organismal process
GO:0032502	0.949	developmental process
GO:0010647	0.949	positive regulation of cell communication
GO:0023056	0.946	positive regulation of signaling
GO:0071704	0.944	organic substance metabolic process
GO:0048856	0.942	anatomical structure development
GO:0009966	0.939	regulation of signal transduction
GO:0044238	0.912	primary metabolic process
GO:0044237	0.904	cellular metabolic process
GO:0007154	0.900	cell communication
GO:0050793	0.895	regulation of developmental process
GO:0007165	0.894	signal transduction
GO:0006807	0.883	nitrogen compound metabolic process
GO:0043170	0.881	macromolecule metabolic process
GO:0042127	0.877	regulation of cell population proliferation
GO:0009893	0.869	positive regulation of metabolic process
GO:1901564	0.864	organonitrogen compound metabolic process
GO:0009967	0.852	positive regulation of signal transduction
GO:0016477	0.850	cell migration
GO:0042221	0.846	response to chemical
GO:0060255	0.829	regulation of macromolecule metabolic process
GO:0048513	0.792	animal organ development
GO:0019538	0.788	protein metabolic process
GO:0002682	0.782	regulation of immune system process
GO:0006796	0.776	phosphate-containing compound metabolic process
GO:0006468	0.765	protein phosphorylation
GO:0002376	0.763	immune system process
GO:0018108	0.762	peptidyl-tyrosine phosphorylation
GO:0045595	0.753	regulation of cell differentiation
GO:0051171	0.746	regulation of nitrogen compound metabolic process
GO:0046777	0.739	protein autophosphorylation
GO:0051174	0.722	regulation of phosphorus metabolic process
GO:0007166	0.721	cell surface receptor signaling pathway
GO:0048519	0.716	negative regulation of biological process
GO:0010468	0.671	regulation of gene expression
GO:0010604	0.660	positive regulation of macromolecule metabolic process
GO:0042325	0.642	regulation of phosphorylation
GO:0007275	0.622	multicellular organism development
GO:0031325	0.613	positive regulation of cellular metabolic process
GO:0051173	0.602	positive regulation of nitrogen compound metabolic process
GO:0065009	0.589	regulation of molecular function
GO:0031399	0.574	regulation of protein modification process
GO:0050790	0.569	regulation of catalytic activity
GO:0019216	0.568	regulation of lipid metabolic process
GO:0051247	0.564	positive regulation of protein metabolic process
GO:1902531	0.556	regulation of intracellular signal transduction
GO:0001932	0.555	regulation of protein phosphorylation
GO:0044093	0.549	positive regulation of molecular function
GO:0070887	0.537	cellular response to chemical stimulus
GO:0048731	0.530	system development
GO:0048523	0.528	negative regulation of cellular process
GO:0030154	0.517	cell differentiation
GO:0042327	0.496	positive regulation of phosphorylation
GO:1902533	0.489	positive regulation of intracellular signal transduction
GO:0010628	0.468	positive regulation of gene expression
GO:0031401	0.464	positive regulation of protein modification process
GO:0002684	0.454	positive regulation of immune system process
GO:0043085	0.453	positive regulation of catalytic activity
GO:0001775	0.444	cell activation
GO:0009889	0.417	regulation of biosynthetic process
GO:0019219	0.415	regulation of nucleobase-containing compound metabolic process
GO:0001934	0.402	positive regulation of protein phosphorylation
GO:0031326	0.391	regulation of cellular biosynthetic process
GO:0010556	0.385	regulation of macromolecule biosynthetic process
GO:0000003	0.383	reproduction
GO:0051252	0.374	regulation of RNA metabolic process
GO:0040011	0.371	locomotion
GO:0043408	0.368	regulation of MAPK cascade
GO:2001141	0.364	regulation of RNA biosynthetic process
GO:0051338	0.358	regulation of transferase activity
GO:0043549	0.351	regulation of kinase activity
GO:2000145	0.349	regulation of cell motility
GO:0006355	0.347	regulation of DNA-templated transcription
GO:0008284	0.346	positive regulation of cell population proliferation
GO:0043410	0.346	positive regulation of MAPK cascade
GO:0071840	0.343	cellular component organization or biogenesis
GO:0009605	0.342	response to external stimulus
GO:0030334	0.338	regulation of cell migration
GO:0001817	0.330	regulation of cytokine production
GO:0007169	0.326	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0051347	0.323	positive regulation of transferase activity
GO:0006950	0.321	response to stress
GO:0071310	0.315	cellular response to organic substance
GO:0033674	0.312	positive regulation of kinase activity
GO:0016043	0.303	cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005622	1.000	intracellular anatomical structure
GO:0005886	1.000	plasma membrane
GO:0043226	0.999	organelle
GO:0005737	0.992	cytoplasm
GO:0043231	0.988	intracellular membrane-bounded organelle
GO:0005634	0.975	nucleus
GO:0012505	0.926	endomembrane system
GO:0031982	0.836	vesicle
GO:0009986	0.640	cell surface
GO:0031410	0.560	cytoplasmic vesicle
GO:0031981	0.447	nuclear lumen
GO:0005654	0.419	nucleoplasm
GO:0098552	0.404	side of membrane
GO:0009897	0.346	external side of plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.10.1	0.996	receptor protein-tyrosine kinase.

[back to server]