StarFunc result for job id P10745

User Input

>input (1247 residues)
MMREWVLLMSVLLCGLAGPTHLFQPSLVLDMAKVLLDNYCFPENLLGMQEAIQQAIKSHE
ILSISDPQTLASVLTAGVQSSLNDPRLVISYEPSTPEPPPQVPALTSLSEEELLAWLQRG
LRHEVLEGNVGYLRVDSVPGQEVLSMMGEFLVAHVWGNLMGTSALVLDLRHCTGGQVSGI
PYIISYLHPGNTILHVDTIYNRPSNTTTEIWTLPQVLGERYGADKDVVVLTSSQTRGVAE
DIAHILKQMRRAIVVGERTGGGALDLRKLRIGESDFFFTVPVSRSLGPLGGGSQTWEGSG
VLPCVGTPAEQALEKALAILTLRSALPGVVHCLQEVLKDYYTLVDRVPTLLQHLASMDFS
TVVSEEDLVTKLNAGLQAASEDPRLLVRAIGPTETPSWPAPDAAAEDSPGVAPELPEDEA
IRQALVDSVFQVSVLPGNVGYLRFDSFADASVLGVLAPYVLRQVWEPLQDTEHLIMDLRH
NPGGPSSAVPLLLSYFQGPEAGPVHLFTTYDRRTNITQEHFSHMELPGPRYSTQRGVYLL
TSHRTATAAEEFAFLMQSLGWATLVGEITAGNLLHTRTVPLLDTPEGSLALTVPVLTFID
NHGEAWLGGGVVPDAIVLAEEALDKAQEVLEFHQSLGALVEGTGHLLEAHYARPEVVGQT
SALLRAKLAQGAYRTAVDLESLASQLTADLQEVSGDHRLLVFHSPGELVVEEAPPPPPAV
PSPEELTYLIEALFKTEVLPGQLGYLRFDAMAELETVKAVGPQLVRLVWQQLVDTAALVI
DLRYNPGSYSTAIPLLCSYFFEAEPRQHLYSVFDRATSKVTEVWTLPQVAGQRYGSHKDL
YILMSHTSGSAAEAFAHTMQDLQRATVIGEPTAGGALSVGIYQVGSSPLYASMPTQMAMS
ATTGKAWDLAGVEPDITVPMSEALSIAQDIVALRAKVPTVLQTAGKLVADNYASAELGAK
MATKLSGLQSRYSRVTSEVALAEILGADLQMLSGDPHLKAAHIPENAKDRIPGIVPMQIP
SPEVFEELIKFSFHTNVLEDNIGYLRFDMFGDGELLTQVSRLLVEHIWKKIMHTDAMIID
MRFNIGGPTSSIPILCSYFFDEGPPVLLDKIYSRPDDSVSELWTHAQVVGERYGSKKSMV
ILTSSVTAGTAEEFTYIMKRLGRALVIGEVTSGGCQPPQTYHVDDTNLYLTIPTARSVGA
SDGSSWEGVGVTPHVVVPAEEALARAKEMLQHNQLRVKRSPGLQDHL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1NA61	0.787	0.793	0.000	1235	0.648	0.654	F1NA61.pdb.gz
2	AFDB:G3V8Q4	0.961	0.971	0.000	1234	0.850	0.859	G3V8Q4.pdb.gz	G3V8Q4_RAT Retinol binding protein 3 OS=Rattus norvegicus OX=10116 GN=Rbp3 PE=4 SV=1
3	AFDB:P10745	1.000	1.000	0.000	1247	1.000	1.000	P10745.pdb.gz	RET3_HUMAN Retinol-binding protein 3 OS=Homo sapiens OX=9606 GN=RBP3 PE=1 SV=2
4	AFDB:Q6P932	0.438	0.838	3.471E-70	630	0.196	0.389	Q6P932.pdb.gz
5	AFDB:P75023	0.177	0.421	4.289E-14	462	0.053	0.143	P75023.pdb.gz	P75023_SYNY3 Carboxyl-terminal protease OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=ctpB PE=3 SV=1
6	AFDB:P73458	0.172	0.446	1.199E-12	423	0.042	0.123	P73458.pdb.gz	P73458_SYNY3 Carboxyl-terminal protease OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=prc PE=3 SV=1
7	AFDB:Q72Q11	0.127	0.320	1.487E-12	462	0.037	0.100	Q72Q11.pdb.gz	Q72Q11_LEPIC Carboxy-terminal processing protease OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) OX=267671 GN=LIC_12303 PE=3 SV=1
8	AFDB:F4KHG6	0.161	0.364	8.756E-12	489	0.043	0.110	F4KHG6.pdb.gz	CTPA1_ARATH Carboxyl-terminal-processing peptidase 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CTPA1 PE=1 SV=1
9	PDB:7rpqA	0.139	0.592	9.016E-12	258	0.041	0.198	7rpqA.pdb.gz
10	AFDB:O23614	0.165	0.363	1.209E-11	515	0.040	0.097	O23614.pdb.gz	CTPA2_ARATH Carboxyl-terminal-processing peptidase 2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CTPA2 PE=1 SV=1
11	AFDB:P23865	0.126	0.218	5.156E-11	682	0.055	0.100	P23865.pdb.gz	PRC_ECOLI Tail-specific protease OS=Escherichia coli (strain K12) OX=83333 GN=prc PE=1 SV=2
12	PDB:4c2dD	0.149	0.454	5.911E-11	343	0.037	0.134	4c2dD.pdb.gz	Ctpb Assembles a Gated Protease Tunnel Regulating Cell-Cell Signaling During Spore Formation in Bacillus Subtilis.
13	PDB:4c2eA	0.128	0.337	8.675E-10	435	0.034	0.099	4c2eA.pdb.gz
14	PDB:1n6dA	0.152	0.182	5.431E-8	1023	0.038	0.046	1n6dA.pdb.gz	Navigation Inside a Protease: Substrate Selection and Product Exit in the Tricorn Protease from Thermoplasma acidophilum
15	PDB:7mi6A	0.063	0.044	2.659E-3	2419	0.095	0.049	7mi6A.pdb.gz	Targeting allostery in the Dynein motor domain with small molecule inhibitors.
16	PDB:4b3iA	0.081	0.126	3.148E-2	731	0.044	0.075	4b3iA.pdb.gz	Structure of Mycobacterial Beta-Oxidation Trifunctional Enzyme Reveals its Altered Assembly and Putative Substrate Channeling Pathway.
17	PDB:3zwaA	0.081	0.132	4.119E-2	727	0.046	0.078	3zwaA.pdb.gz	The Isomerase and Hydratase Reaction Mechanism of the Crotonase Active Site of the Multifunctional Enzyme (Type-1), as Deduced from Structures of Complexes with 3S-Hydroxy- Acyl-Coa.
18	PDB:4w8fB	0.051	0.030	4.119E-2	2609	0.047	0.023	4w8fB.pdb.gz	Allosteric communication in the Dynein motor domain.
19	PDB:5cskA	0.070	0.048	5.106E-2	1996	0.065	0.041	5cskA.pdb.gz
20	PDB:7oeqA	0.093	0.327	5.106E-2	259	0.030	0.143	7oeqA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1SEL7	0.0	2080	1284	0.836	0.812	F1SEL7_PIG Retinol binding protein 3 OS=Sus scrofa OX=9823 GN=RBP3 PE=1 SV=2
2	G1N7C9	0.0	1654	1206	0.646	0.668	G1N7C9_MELGA Retinol binding protein 3 OS=Meleagris gallopavo OX=9103 GN=RBP3 PE=4 SV=2
3	G3V8Q4	0.0	2143	1234	0.851	0.860	G3V8Q4_RAT Retinol binding protein 3 OS=Rattus norvegicus OX=10116 GN=Rbp3 PE=4 SV=1
4	P10745	0.0	2533	1247	1.000	1.000	RET3_HUMAN Retinol-binding protein 3 OS=Homo sapiens OX=9606 GN=RBP3 PE=1 SV=2
5	Q52P71	0.0	1659	1235	0.651	0.657	Q52P71_CHICK Interphotoreceptor retinoid binding protein OS=Gallus gallus OX=9031 PE=2 SV=1
6	F1Q9N9	5.47e-152	472	615	0.196	0.398	F1Q9N9_DANRE Retinol-binding protein 3 OS=Danio rerio OX=7955 GN=irbp PE=1 SV=2
7	A0A8A1UD18	2.55e-53	184	116	0.072	0.776	A0A8A1UD18_RAT Retinol-binding protein 2 (Fragment) OS=Rattus norvegicus OX=10116 GN=Rbp3 PE=4 SV=1
8	A0A8A1UAJ7	1.32e-52	182	116	0.071	0.767	A0A8A1UAJ7_RAT Retinol-binding protein 2 (Fragment) OS=Rattus norvegicus OX=10116 GN=Rbp3 PE=4 SV=1
9	A0A8A1UF31	8.28e-46	162	118	0.066	0.695	A0A8A1UF31_RAT Retinol-binding protein 2 (Fragment) OS=Rattus norvegicus OX=10116 GN=Rbp3 PE=4 SV=1
10	A0A8A1UIS1	2.62e-10	58.5	37	0.025	0.838	A0A8A1UIS1_RAT Retinol-binding protein 2 (Fragment) OS=Rattus norvegicus OX=10116 GN=Rbp3 PE=4 SV=1
11	P73458	4.34e-06	53.1	423	0.045	0.132	P73458_SYNY3 Carboxyl-terminal protease OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=prc PE=3 SV=1
12	P23865	3.12e-04	47.4	682	0.046	0.084	PRC_ECOLI Tail-specific protease OS=Escherichia coli (strain K12) OX=83333 GN=prc PE=1 SV=2
13	Q72Q11	0.001	45.4	462	0.038	0.102	Q72Q11_LEPIC Carboxy-terminal processing protease OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) OX=267671 GN=LIC_12303 PE=3 SV=1
14	Q9HYY3	0.003	44.7	698	0.037	0.066	Q9HYY3_PSEAE Periplasmic tail-specific protease OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=prc PE=3 SV=1
15	P75023	0.009	42.4	462	0.041	0.110	P75023_SYNY3 Carboxyl-terminal protease OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=ctpB PE=3 SV=1
16	Q729L4	0.065	39.7	428	0.036	0.105	Q729L4_DESVH Carboxyl-terminal protease OS=Desulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / NCIMB 8303 / VKM B-1760 / Hildenborough) OX=882 GN=DVU_2336 PE=1 SV=1
17	O35002	0.076	39.7	480	0.029	0.075	CTPB_BACSU Carboxy-terminal processing protease CtpB OS=Bacillus subtilis (strain 168) OX=224308 GN=ctpB PE=1 SV=1
18	Q9HU50	0.29	37.7	436	0.044	0.126	Q9HU50_PSEAE Probable carboxyl-terminal protease OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=PA5134 PE=1 SV=1
19	F4KHG6	0.51	37.0	489	0.030	0.078	CTPA1_ARATH Carboxyl-terminal-processing peptidase 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CTPA1 PE=1 SV=1
20	Q9P7F7	1.4	34.7	222	0.018	0.099	SNF7_SCHPO Vacuolar-sorting protein snf7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=snf7 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10291 muHD	1.1e+02	13.7	Muniscin C-terminal mu homology domain
2	PF03572 Peptidase_S41	2.6e-81	282.5	Peptidase family S41
3	PF11918 Peptidase_S41_N	2.3e-135	456.3	N-terminal domain of Peptidase_S41 in eukaryotic IRBP

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000463151

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000226193	0.982	Recoverin
2	9606.ENSP00000249389	0.791	Short-wave-sensitive opsin 1
3	9606.ENSP00000386444	0.777	S-arrestin
4	9606.ENSP00000349629	0.764	Lipopolysaccharide-responsive and beige-like anchor protein
5	9606.ENSP00000296271	0.757	Rhodopsin
6	9606.ENSP00000268125	0.746	Retinaldehyde-binding protein 1
7	9606.ENSP00000232219	0.723	Retinol-binding protein 1
8	9606.ENSP00000232217	0.720	Retinol-binding protein 2
9	9606.ENSP00000262340	0.717	Retinoid isomerohydrolase
10	9606.ENSP00000251337	0.714	Guanine nucleotide-binding protein G(t) subunit alpha-2
11	9606.ENSP00000248572	0.710	Guanine nucleotide-binding protein G(T) subunit gamma-T1
12	9606.ENSP00000370826	0.683	Lysine-specific demethylase hairless
13	9606.ENSP00000311538	0.678	Arrestin-C
14	9606.ENSP00000248564	0.652	Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-11
15	9606.ENSP00000482841	0.645	Cellular retinoic acid-binding protein 2
16	9606.ENSP00000318373	0.640	Zinc finger protein 513
17	9606.ENSP00000375855	0.634	Phosducin
18	9606.ENSP00000293502	0.626	Short-chain dehydrogenase/reductase family 9C member 7
19	9606.ENSP00000229771	0.625	Tubby-related protein 1
20	9606.ENSP00000354554	0.608	Cytochrome b

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019841	1.000	retinol binding
GO:0005515	0.994	protein binding
GO:0043167	0.666	ion binding
GO:0043168	0.329	anion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.991	cellular process
GO:0032501	0.982	multicellular organismal process
GO:0050953	0.915	sensory perception of light stimulus
GO:0007601	0.910	visual perception
GO:0071704	0.901	organic substance metabolic process
GO:0044237	0.901	cellular metabolic process
GO:0044238	0.881	primary metabolic process
GO:0001523	0.817	retinoid metabolic process
GO:0050896	0.561	response to stimulus
GO:0065007	0.307	biological regulation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071944	0.997	cell periphery
GO:0043227	0.979	membrane-bounded organelle
GO:0030312	0.910	external encapsulating structure
GO:0062023	0.876	collagen-containing extracellular matrix
GO:0005622	0.783	intracellular anatomical structure
GO:0005737	0.764	cytoplasm
GO:0016020	0.702	membrane
GO:0005576	0.477	extracellular region
GO:0043231	0.447	intracellular membrane-bounded organelle
GO:0031982	0.344	vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]