StarFunc result for job id P10747

User Input

>input (220 residues)
MLRLLLALNLFPSIQVTGNKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLD
SAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPP
PYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAFIIFWVR
SKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P10747	1.000	1.000	1.299E-39	220	1.000	1.000	P10747.pdb.gz	CD28_HUMAN T-cell-specific surface glycoprotein CD28 OS=Homo sapiens OX=9606 GN=CD28 PE=1 SV=1
2	AFDB:P31041	0.576	0.580	8.998E-27	218	0.691	0.697	P31041.pdb.gz	CD28_MOUSE T-cell-specific surface glycoprotein CD28 OS=Mus musculus OX=10090 GN=Cd28 PE=1 SV=2
3	AFDB:A0A096MJE4	0.518	0.511	3.801E-14	223	0.291	0.287	A0A096MJE4.pdb.gz	A0A096MJE4_RAT Cytotoxic T-lymphocyte protein 4 OS=Rattus norvegicus OX=10116 GN=Ctla4 PE=4 SV=1
4	AFDB:P16410	0.502	0.496	4.735E-14	223	0.286	0.283	P16410.pdb.gz	CTLA4_HUMAN Cytotoxic T-lymphocyte protein 4 OS=Homo sapiens OX=9606 GN=CTLA4 PE=1 SV=3
5	AFDB:P09793	0.471	0.465	1.871E-13	223	0.286	0.283	P09793.pdb.gz	CTLA4_MOUSE Cytotoxic T-lymphocyte protein 4 OS=Mus musculus OX=10090 GN=Ctla4 PE=1 SV=1
6	AFDB:A0A2R8QN30	0.414	0.401	2.811E-9	228	0.177	0.171	A0A2R8QN30.pdb.gz	A0A2R8QN30_DANRE Myelin protein P0 isoform X1 OS=Danio rerio OX=7955 GN=p0 PE=1 SV=1
7	AFDB:T1NXB5	0.488	0.367	6.771E-9	319	0.168	0.116	T1NXB5.pdb.gz	VSTM4_MOUSE V-set and transmembrane domain-containing protein 4 OS=Mus musculus OX=10090 GN=Vstm4 PE=1 SV=1
8	AFDB:P06907	0.414	0.372	7.154E-9	248	0.141	0.125	P06907.pdb.gz	MYP0_RAT Myelin protein P0 OS=Rattus norvegicus OX=10116 GN=Mpz PE=1 SV=1
9	AFDB:Q9Y6W8	0.438	0.479	7.154E-9	199	0.214	0.236	Q9Y6W8.pdb.gz	ICOS_HUMAN Inducible T-cell costimulator OS=Homo sapiens OX=9606 GN=ICOS PE=1 SV=1
10	AFDB:Q8IW00	0.406	0.311	8.436E-9	320	0.182	0.125	Q8IW00.pdb.gz	VSTM4_HUMAN V-set and transmembrane domain-containing protein 4 OS=Homo sapiens OX=9606 GN=VSTM4 PE=1 SV=3
11	PDB:1ohqA	0.367	0.597	2.403E-6	120	0.091	0.167	1ohqA.pdb.gz
12	PDB:4m62L	0.338	0.592	2.539E-6	113	0.105	0.204	4m62L.pdb.gz
13	PDB:1cd0A	0.359	0.633	2.682E-6	111	0.077	0.153	1cd0A.pdb.gz
14	PDB:6hd8A	0.419	0.214	3.342E-6	461	0.077	0.037	6hd8A.pdb.gz	Structural basis for ion selectivity in TMEM175 K+channels.
15	PDB:5ir3A	0.367	0.650	4.399E-6	111	0.077	0.153	5ir3A.pdb.gz
16	PDB:2q20B	0.356	0.622	4.910E-6	109	0.109	0.220	2q20B.pdb.gz
17	PDB:1wtlA	0.332	0.600	6.117E-6	108	0.100	0.204	1wtlA.pdb.gz
18	PDB:6sm1A	0.335	0.614	6.117E-6	111	0.068	0.135	6sm1A.pdb.gz	Fatal amyloid formation in a patient's antibody light chain is caused by a single point mutation.
19	PDB:1q0xL	0.324	0.334	6.462E-6	212	0.091	0.094	1q0xL.pdb.gz
20	PDB:2cd0A	0.332	0.585	6.462E-6	111	0.073	0.144	2cd0A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P10747	2.41e-165	456	220	1.000	1.000	CD28_HUMAN T-cell-specific surface glycoprotein CD28 OS=Homo sapiens OX=9606 GN=CD28 PE=1 SV=1
2	P31042	2.04e-104	302	218	0.700	0.706	CD28_RAT T-cell-specific surface glycoprotein CD28 OS=Rattus norvegicus OX=10116 GN=Cd28 PE=2 SV=1
3	P31041	1.20e-103	300	218	0.691	0.697	CD28_MOUSE T-cell-specific surface glycoprotein CD28 OS=Mus musculus OX=10090 GN=Cd28 PE=1 SV=2
4	Q62859	5.08e-18	81.3	223	0.314	0.309	Q62859_RAT Cytotoxic T-lymphocyte protein 4 OS=Rattus norvegicus OX=10116 GN=Ctla4 PE=2 SV=1
5	A0A096MJE4	5.24e-18	81.3	223	0.314	0.309	A0A096MJE4_RAT Cytotoxic T-lymphocyte protein 4 OS=Rattus norvegicus OX=10116 GN=Ctla4 PE=4 SV=1
6	P09793	1.63e-16	77.4	223	0.295	0.291	CTLA4_MOUSE Cytotoxic T-lymphocyte protein 4 OS=Mus musculus OX=10090 GN=Ctla4 PE=1 SV=1
7	P16410	2.72e-15	73.9	223	0.273	0.269	CTLA4_HUMAN Cytotoxic T-lymphocyte protein 4 OS=Homo sapiens OX=9606 GN=CTLA4 PE=1 SV=3
8	G3V7D2	8.10e-10	58.2	174	0.200	0.253	G3V7D2_RAT Cytotoxic T-lymphocyte protein 4 OS=Rattus norvegicus OX=10116 GN=Ctla4 PE=4 SV=2
9	Q9R1T7	3.40e-07	51.2	200	0.195	0.215	ICOS_RAT Inducible T-cell costimulator OS=Rattus norvegicus OX=10116 GN=Icos PE=1 SV=1
10	Q9Y6W8	3.68e-07	51.2	199	0.173	0.191	ICOS_HUMAN Inducible T-cell costimulator OS=Homo sapiens OX=9606 GN=ICOS PE=1 SV=1
11	Q9WVS0	2.04e-05	46.2	200	0.200	0.220	ICOS_MOUSE Inducible T-cell costimulator OS=Mus musculus OX=10090 GN=Icos PE=1 SV=2
12	P18275	0.46	33.9	482	0.068	0.031	ARCD_PSEAE Arginine/ornithine antiporter OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=arcD PE=1 SV=1
13	Q13443	0.48	33.9	819	0.091	0.024	ADAM9_HUMAN Disintegrin and metalloproteinase domain-containing protein 9 OS=Homo sapiens OX=9606 GN=ADAM9 PE=1 SV=1
14	Q389H8	1.2	32.3	634	0.105	0.036	Q389H8_TRYB2 PSP1 C-terminal domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.26.0280 PE=4 SV=1
15	G5EGJ9	2.5	31.6	1367	0.086	0.014	DEP1_CAEEL Receptor-type tyrosine-protein phosphatase dep-1 OS=Caenorhabditis elegans OX=6239 GN=dep-1 PE=1 SV=1
16	Q96HA8	7.1	29.6	205	0.055	0.059	NTAQ1_HUMAN Protein N-terminal glutamine amidohydrolase OS=Homo sapiens OX=9606 GN=NTAQ1 PE=1 SV=2
17	F4HZU8	9.2	29.6	564	0.118	0.046	F4HZU8_ARATH Calcium-binding EF-hand family protein OS=Arabidopsis thaliana OX=3702 GN=At1g29020 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07686 V-set	0.017	26.7	Immunoglobulin V-set domain
2	PF15910 V-set_2	2.4e-10	51.9	ICOS V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000324890

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000264246	0.999	T-lymphocyte activation antigen CD80
2	9606.ENSP00000332049	0.999	T-lymphocyte activation antigen CD86
3	9606.ENSP00000337825	0.999	Tyrosine-protein kinase Lck
4	9606.ENSP00000376345	0.999	Growth factor receptor-bound protein 2
5	9606.ENSP00000011653	0.996	T-cell surface glycoprotein CD4
6	9606.ENSP00000263125	0.996	Protein kinase C theta type
7	9606.ENSP00000354782	0.995	T-cell surface glycoprotein CD3 zeta chain
8	9606.ENSP00000428056	0.993	Phosphatidylinositol 3-kinase regulatory subunit alpha
9	9606.ENSP00000339477	0.992	Inducible T-cell co-stimulator ligand
10	9606.ENSP00000358490	0.991	T-cell surface antigen CD2
11	9606.ENSP00000386559	0.991	T-cell surface glycoprotein CD8 alpha chain
12	9606.ENSP00000398655	0.988	Tyrosine-protein kinase ITK/TSK
13	9606.ENSP00000264972	0.987	Tyrosine-protein kinase ZAP-70
14	9606.ENSP00000339186	0.981	GRB2-related adapter protein 2
15	9606.ENSP00000380227	0.981	Integrin alpha-4
16	9606.ENSP00000354566	0.980	T-cell surface glycoprotein CD3 epsilon chain
17	9606.ENSP00000320084	0.970	CD276 antigen
18	9606.ENSP00000433642	0.969	Low affinity immunoglobulin gamma Fc region receptor III-B
19	9606.ENSP00000356946	0.968	Low affinity immunoglobulin gamma Fc region receptor III-A
20	9606.ENSP00000358866	0.968	Filamin-A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0038023	0.999	signaling receptor activity
GO:0019899	0.997	enzyme binding
GO:0015026	0.933	coreceptor activity
GO:0002020	0.928	protease binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0050794	0.995	regulation of cellular process
GO:0048522	0.994	positive regulation of cellular process
GO:0001775	0.992	cell activation
GO:0050896	0.988	response to stimulus
GO:0002684	0.980	positive regulation of immune system process
GO:0051240	0.979	positive regulation of multicellular organismal process
GO:0050870	0.974	positive regulation of T cell activation
GO:0046649	0.971	lymphocyte activation
GO:0042110	0.962	T cell activation
GO:0007165	0.960	signal transduction
GO:0060255	0.958	regulation of macromolecule metabolic process
GO:0006955	0.943	immune response
GO:0007166	0.939	cell surface receptor signaling pathway
GO:0048856	0.937	anatomical structure development
GO:0009893	0.903	positive regulation of metabolic process
GO:0042127	0.890	regulation of cell population proliferation
GO:0010604	0.881	positive regulation of macromolecule metabolic process
GO:0008284	0.874	positive regulation of cell population proliferation
GO:0070663	0.866	regulation of leukocyte proliferation
GO:0010468	0.865	regulation of gene expression
GO:0042129	0.848	regulation of T cell proliferation
GO:0070665	0.820	positive regulation of leukocyte proliferation
GO:0030098	0.816	lymphocyte differentiation
GO:0050671	0.798	positive regulation of lymphocyte proliferation
GO:0001817	0.780	regulation of cytokine production
GO:0042102	0.758	positive regulation of T cell proliferation
GO:0048583	0.749	regulation of response to stimulus
GO:0010628	0.721	positive regulation of gene expression
GO:0048523	0.714	negative regulation of cellular process
GO:0042981	0.629	regulation of apoptotic process
GO:0001819	0.550	positive regulation of cytokine production
GO:0048584	0.474	positive regulation of response to stimulus
GO:0051128	0.472	regulation of cellular component organization
GO:0031295	0.402	T cell costimulation
GO:0051130	0.394	positive regulation of cellular component organization
GO:0050776	0.356	regulation of immune response
GO:0051171	0.335	regulation of nitrogen compound metabolic process
GO:0031323	0.333	regulation of cellular metabolic process
GO:0080090	0.331	regulation of primary metabolic process
GO:0060548	0.318	negative regulation of cell death
GO:0050778	0.307	positive regulation of immune response
GO:0051785	0.300	positive regulation of nuclear division

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.998	plasma membrane
GO:0009986	0.990	cell surface
GO:0005829	0.973	cytosol
GO:0032991	0.946	protein-containing complex
GO:0098552	0.897	side of membrane
GO:0009897	0.882	external side of plasma membrane
GO:0043231	0.809	intracellular membrane-bounded organelle
GO:0098636	0.497	protein complex involved in cell adhesion

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]