StarFunc result for job id P10767

User Input

>input (208 residues)
MALGQKLFITMSRGAGRLQGTLWALVFLGILVGMVVPSPAGTRANNTLLDSRGWGTLLSR
SRAGLAGEIAGVNWESGYLVGIKRQRRLYCNVGIGFHLQVLPDGRISGTHEENPYSLLEI
STVERGVVSLFGVRSALFVAMNSKGRLYATPSFQEECKFRETLLPNNYNAYESDLYQGTY
IALSKYGRVKRGSKVSPIMTVTHFLPRI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P10767	1.000	1.000	7.884E-39	208	1.000	1.000	P10767.pdb.gz	FGF6_HUMAN Fibroblast growth factor 6 OS=Homo sapiens OX=9606 GN=FGF6 PE=1 SV=4
2	AFDB:P48805	0.651	0.724	6.798E-25	187	0.558	0.620	P48805.pdb.gz	FGF4A_XENLA Fibroblast growth factor 4A OS=Xenopus laevis OX=8355 GN=fgf4-a PE=2 SV=1
3	AFDB:Q9DFC9	0.621	0.675	4.474E-24	191	0.534	0.581	Q9DFC9.pdb.gz	Q9DFC9_DANRE Fibroblast growth factor OS=Danio rerio OX=7955 GN=fc89b01 PE=2 SV=1
4	AFDB:P11403	0.639	0.658	2.232E-23	202	0.510	0.525	P11403.pdb.gz	FGF4_MOUSE Fibroblast growth factor 4 OS=Mus musculus OX=10090 GN=Fgf4 PE=2 SV=2
5	AFDB:P08620	0.618	0.624	5.872E-22	206	0.500	0.505	P08620.pdb.gz	FGF4_HUMAN Fibroblast growth factor 4 OS=Homo sapiens OX=9606 GN=FGF4 PE=1 SV=1
6	AFDB:A0A2R8QRV4	0.595	0.551	1.410E-17	225	0.341	0.316	A0A2R8QRV4.pdb.gz
7	AFDB:P12034	0.595	0.465	5.332E-17	268	0.351	0.272	P12034.pdb.gz	FGF5_HUMAN Fibroblast growth factor 5 OS=Homo sapiens OX=9606 GN=FGF5 PE=1 SV=4
8	AFDB:P70492	0.593	0.574	5.956E-17	215	0.312	0.302	P70492.pdb.gz	FGF10_RAT Fibroblast growth factor 10 OS=Rattus norvegicus OX=10116 GN=Fgf10 PE=2 SV=1
9	AFDB:P48807	0.590	0.466	9.809E-17	266	0.346	0.271	P48807.pdb.gz	FGF5_RAT Fibroblast growth factor 5 OS=Rattus norvegicus OX=10116 GN=Fgf5 PE=2 SV=1
10	AFDB:P09038	0.586	0.429	1.707E-16	288	0.317	0.229	P09038.pdb.gz	FGF2_HUMAN Fibroblast growth factor 2 OS=Homo sapiens OX=9606 GN=FGF2 PE=1 SV=3
11	PDB:3f1rA	0.577	0.760	1.317E-13	157	0.260	0.344	3f1rA.pdb.gz	Homodimerization controls the fibroblast growth factor 9 subfamily's receptor binding and heparan sulfate-dependent diffusion in the extracellular matrix
12	PDB:4jq0A	0.570	0.832	1.350E-12	141	0.231	0.340	4jq0A.pdb.gz	Structural analyses of Ca(2+)/CaM interaction with NaV channel C-termini reveal mechanisms of calcium-dependent regulation.
13	PDB:1ry7A	0.569	0.777	2.040E-11	151	0.207	0.285	1ry7A.pdb.gz
14	PDB:6b0tA	0.506	0.227	2.371E-5	487	0.077	0.033	6b0tA.pdb.gz	Structural Insights into the Induced-fit Inhibition of Fascin by a Small-Molecule Inhibitor.
15	PDB:3wmuB	0.461	0.607	4.003E-4	153	0.067	0.092	3wmuB.pdb.gz
16	PDB:4qd2B	0.504	0.706	5.281E-4	143	0.043	0.063	4qd2B.pdb.gz	Molecular basis for disruption of E-cadherin adhesion by botulinum neurotoxin A complex.
17	PDB:1t9fA	0.459	0.528	6.968E-4	178	0.082	0.096	1t9fA.pdb.gz
18	PDB:4qd2C	0.537	0.397	7.365E-4	286	0.058	0.042	4qd2C.pdb.gz	Molecular basis for disruption of E-cadherin adhesion by botulinum neurotoxin A complex.
19	PDB:7t3qA	0.461	0.054	9.192E-4	2103	0.120	0.012	7t3qA.pdb.gz	Structural basis for activation and gating of IP 3 receptors.
20	PDB:2d43A	0.478	0.218	1.432E-3	482	0.077	0.033	2d43A.pdb.gz	The family 42 carbohydrate-binding module of family 54 alpha-L-arabinofuranosidase specifically binds the arabinofuranose side chain of hemicellulose

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P10767	7.27e-153	423	208	1.000	1.000	FGF6_HUMAN Fibroblast growth factor 6 OS=Homo sapiens OX=9606 GN=FGF6 PE=1 SV=4
2	Q8R5L5	3.86e-144	401	208	0.938	0.938	Q8R5L5_RAT Fibroblast growth factor OS=Rattus norvegicus OX=10116 GN=Fgf6 PE=2 SV=1
3	P21658	2.21e-143	399	208	0.933	0.933	FGF6_MOUSE Fibroblast growth factor 6 OS=Mus musculus OX=10090 GN=Fgf6 PE=2 SV=2
4	P48805	6.90e-76	228	187	0.558	0.620	FGF4A_XENLA Fibroblast growth factor 4A OS=Xenopus laevis OX=8355 GN=fgf4-a PE=2 SV=1
5	Q9DFC9	1.83e-72	219	191	0.553	0.602	Q9DFC9_DANRE Fibroblast growth factor OS=Danio rerio OX=7955 GN=fc89b01 PE=2 SV=1
6	P08620	7.54e-64	198	206	0.505	0.510	FGF4_HUMAN Fibroblast growth factor 4 OS=Homo sapiens OX=9606 GN=FGF4 PE=1 SV=1
7	P11403	2.94e-57	181	202	0.490	0.505	FGF4_MOUSE Fibroblast growth factor 4 OS=Mus musculus OX=10090 GN=Fgf4 PE=2 SV=2
8	P12034	1.09e-35	128	268	0.303	0.235	FGF5_HUMAN Fibroblast growth factor 5 OS=Homo sapiens OX=9606 GN=FGF5 PE=1 SV=4
9	Q5TLE2	1.54e-35	126	225	0.341	0.316	Q5TLE2_DANRE Fibroblast growth factor OS=Danio rerio OX=7955 GN=fgf5 PE=2 SV=1
10	P15656	8.52e-35	125	264	0.298	0.235	FGF5_MOUSE Fibroblast growth factor 5 OS=Mus musculus OX=10090 GN=Fgf5 PE=2 SV=1
11	P48807	8.65e-35	125	266	0.298	0.233	FGF5_RAT Fibroblast growth factor 5 OS=Rattus norvegicus OX=10116 GN=Fgf5 PE=2 SV=1
12	Q9EST9	1.99e-28	107	212	0.365	0.358	FGF20_RAT Fibroblast growth factor 20 OS=Rattus norvegicus OX=10116 GN=Fgf20 PE=2 SV=1
13	Q9ESL9	2.49e-28	107	211	0.361	0.355	FGF20_MOUSE Fibroblast growth factor 20 OS=Mus musculus OX=10090 GN=Fgf20 PE=2 SV=2
14	Q9NP95	7.23e-28	106	211	0.274	0.270	FGF20_HUMAN Fibroblast growth factor 20 OS=Homo sapiens OX=9606 GN=FGF20 PE=1 SV=1
15	Q38PL0	1.02e-27	105	208	0.274	0.274	Q38PL0_DANRE Fibroblast growth factor OS=Danio rerio OX=7955 GN=dob PE=2 SV=1
16	P36364	1.10e-27	105	208	0.269	0.269	FGF9_RAT Fibroblast growth factor 9 OS=Rattus norvegicus OX=10116 GN=Fgf9 PE=2 SV=2
17	P54130	1.10e-27	105	208	0.269	0.269	FGF9_MOUSE Fibroblast growth factor 9 OS=Mus musculus OX=10090 GN=Fgf9 PE=2 SV=2
18	P31371	1.15e-27	105	208	0.269	0.269	FGF9_HUMAN Fibroblast growth factor 9 OS=Homo sapiens OX=9606 GN=FGF9 PE=1 SV=3
19	Q2LJ24	1.65e-27	105	208	0.269	0.269	Q2LJ24_DANRE Fibroblast growth factor OS=Danio rerio OX=7955 GN=fgf20b PE=2 SV=1
20	P15655	3.08e-27	103	154	0.284	0.383	FGF2_MOUSE Fibroblast growth factor 2 OS=Mus musculus OX=10090 GN=Fgf2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00167 FGF	5.2e-38	141.3	Fibroblast growth factor

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000228837

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000393312	0.992	Fibroblast growth factor receptor 1
2	9606.ENSP00000292408	0.970	Fibroblast growth factor receptor 4
3	9606.ENSP00000410294	0.936	Fibroblast growth factor receptor 2
4	9606.ENSP00000407586	0.934	GTPase HRas
5	9606.ENSP00000263025	0.931	Mitogen-activated protein kinase 3
6	9606.ENSP00000256078	0.918	GTPase KRas
7	9606.ENSP00000215832	0.916	Mitogen-activated protein kinase 1
8	9606.ENSP00000264498	0.916	Fibroblast growth factor 2
9	9606.ENSP00000358548	0.908	GTPase NRas
10	9606.ENSP00000361818	0.908	Syndecan-4
11	9606.ENSP00000262648	0.904	Anosmin-1
12	9606.ENSP00000339824	0.865	Fibroblast growth factor receptor 3
13	9606.ENSP00000263923	0.815	Vascular endothelial growth factor receptor 2
14	9606.ENSP00000282397	0.778	Vascular endothelial growth factor receptor 1
15	9606.ENSP00000261937	0.766	Vascular endothelial growth factor receptor 3
16	9606.ENSP00000261799	0.760	Platelet-derived growth factor receptor beta
17	9606.ENSP00000288135	0.759	Mast/stem cell growth factor receptor Kit
18	9606.ENSP00000369375	0.755	Angiopoietin-1 receptor
19	9606.ENSP00000275493	0.739	Epidermal growth factor receptor
20	9606.ENSP00000447241	0.734	Fibroblast growth factor receptor substrate 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008083	1.000	growth factor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0050896	0.990	response to stimulus
GO:0032502	0.990	developmental process
GO:0050794	0.988	regulation of cellular process
GO:0048518	0.964	positive regulation of biological process
GO:0023052	0.963	signaling
GO:0048856	0.961	anatomical structure development
GO:0051716	0.946	cellular response to stimulus
GO:0007154	0.938	cell communication
GO:0032501	0.936	multicellular organismal process
GO:0048522	0.928	positive regulation of cellular process
GO:0070848	0.893	response to growth factor
GO:0007275	0.856	multicellular organism development
GO:0007165	0.852	signal transduction
GO:0007166	0.828	cell surface receptor signaling pathway
GO:0048731	0.825	system development
GO:0007169	0.764	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0071495	0.751	cellular response to endogenous stimulus
GO:0042127	0.742	regulation of cell population proliferation
GO:0071363	0.736	cellular response to growth factor stimulus
GO:0071774	0.686	response to fibroblast growth factor
GO:0019222	0.670	regulation of metabolic process
GO:0060255	0.601	regulation of macromolecule metabolic process
GO:0048513	0.573	animal organ development
GO:0030154	0.565	cell differentiation
GO:0008284	0.524	positive regulation of cell population proliferation
GO:0009893	0.480	positive regulation of metabolic process
GO:0010604	0.450	positive regulation of macromolecule metabolic process
GO:0009653	0.428	anatomical structure morphogenesis
GO:0080090	0.414	regulation of primary metabolic process
GO:0031323	0.414	regulation of cellular metabolic process
GO:0048519	0.407	negative regulation of biological process
GO:0010646	0.403	regulation of cell communication
GO:0048583	0.401	regulation of response to stimulus
GO:0023051	0.388	regulation of signaling
GO:0044344	0.382	cellular response to fibroblast growth factor stimulus
GO:0051171	0.369	regulation of nitrogen compound metabolic process
GO:0009966	0.360	regulation of signal transduction
GO:0008543	0.359	fibroblast growth factor receptor signaling pathway
GO:0031325	0.353	positive regulation of cellular metabolic process
GO:0048523	0.333	negative regulation of cellular process
GO:0051173	0.325	positive regulation of nitrogen compound metabolic process
GO:0048584	0.322	positive regulation of response to stimulus
GO:0010468	0.312	regulation of gene expression
GO:0042221	0.302	response to chemical

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	1.000	extracellular region
GO:0005886	0.996	plasma membrane
GO:0005622	0.794	intracellular anatomical structure
GO:0005737	0.618	cytoplasm
GO:0043226	0.564	organelle
GO:0043227	0.496	membrane-bounded organelle
GO:0043229	0.480	intracellular organelle
GO:0005615	0.398	extracellular space

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]