StarFunc result for job id P10809

User Input

>input (573 residues)
MLRLPTVFRQMRPVSRVLAPHLTRAYAKDVKFGADARALMLQGVDLLADAVAVTMGPKGR
TVIIEQSWGSPKVTKDGVTVAKSIDLKDKYKNIGAKLVQDVANNTNEEAGDGTTTATVLA
RSIAKEGFEKISKGANPVEIRRGVMLAVDAVIAELKKQSKPVTTPEEIAQVATISANGDK
EIGNIISDAMKKVGRKGVITVKDGKTLNDELEIIEGMKFDRGYISPYFINTSKGQKCEFQ
DAYVLLSEKKISSIQSIVPALEIANAHRKPLVIIAEDVDGEALSTLVLNRLKVGLQVVAV
KAPGFGDNRKNQLKDMAIATGGAVFGEEGLTLNLEDVQPHDLGKVGEVIVTKDDAMLLKG
KGDKAQIEKRIQEIIEQLDVTTSEYEKEKLNERLAKLSDGVAVLKVGGTSDVEVNEKKDR
VTDALNATRAAVEEGIVLGGGCALLRCIPALDSLTPANEDQKIGIEIIKRTLKIPAMTIA
KNAGVEGSLIVEKIMQSSSEVGYDAMAGDFVNMVEKGIIDPTKVVRTALLDAAGVASLLT
TAEVVVTEIPKEEKDPGMGAMGGMGGGMGGGMF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R3X4	0.707	0.707	1.373E-94	573	1.000	1.000	A0A024R3X4.pdb.gz	A0A024R3X4_HUMAN 60 kDa heat shock protein, mitochondrial (Fragment) OS=Homo sapiens OX=9606 GN=HSPD1 PE=2 SV=1
2	AFDB:Q803B0	0.965	0.962	2.760E-90	575	0.873	0.870	Q803B0.pdb.gz	Q803B0_DANRE 60 kDa heat shock protein, mitochondrial OS=Danio rerio OX=7955 GN=cb863 PE=1 SV=1
3	AFDB:O02649	0.666	0.666	5.101E-81	573	0.742	0.742	O02649.pdb.gz	CH60A_DROME Heat shock protein 60A OS=Drosophila melanogaster OX=7227 GN=Hsp60A PE=1 SV=3
4	PDB:6ht7J	0.885	0.959	1.677E-80	528	0.918	0.996	6ht7J.pdb.gz	Crystal structure of the WT human mitochondrial football Hsp60-Hsp10(ADPBeFx)14 complex
5	AFDB:Q9VMN5	0.666	0.662	7.211E-80	576	0.712	0.708	Q9VMN5.pdb.gz	CH60C_DROME 60 kDa heat shock protein homolog 2, mitochondrial OS=Drosophila melanogaster OX=7227 GN=Hsp60C PE=2 SV=2
6	AFDB:P50140	0.654	0.659	1.674E-76	568	0.703	0.710	P50140.pdb.gz	CH60_CAEEL Chaperonin homolog Hsp-60, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=hsp-60 PE=2 SV=2
7	AFDB:P29185	0.671	0.667	1.092E-71	577	0.574	0.570	P29185.pdb.gz	CH61_MAIZE Chaperonin CPN60-1, mitochondrial OS=Zea mays OX=4577 GN=CPN60I PE=1 SV=2
8	AFDB:Q09864	0.667	0.657	3.394E-69	582	0.553	0.545	Q09864.pdb.gz	HSP60_SCHPO Heat shock protein 60, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=hsp60 PE=1 SV=1
9	AFDB:Q5B041	0.658	0.642	8.207E-69	588	0.564	0.549	Q5B041.pdb.gz	HSP60_EMENI Heat shock protein 60 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=hsp60 PE=1 SV=1
10	AFDB:P29197	0.653	0.649	8.619E-69	577	0.571	0.567	P29197.pdb.gz	CH60A_ARATH Chaperonin CPN60, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=CPN60 PE=1 SV=2
11	AFDB:Q8L7B5	0.648	0.635	9.508E-69	585	0.572	0.561	Q8L7B5.pdb.gz	CH60B_ARATH Chaperonin CPN60-like 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At2g33210 PE=1 SV=1
12	PDB:3rtkA	0.476	0.597	2.888E-44	448	0.363	0.464	3rtkA.pdb.gz
13	PDB:6tmuA	0.551	0.572	1.747E-31	550	0.222	0.231	6tmuA.pdb.gz	Structure and conformational cycle of a bacteriophage-encoded chaperonin.
14	PDB:3kfeA	0.668	0.773	9.312E-29	487	0.204	0.240	3kfeA.pdb.gz	Crystal structures of a group II chaperonin reveal the open and closed states associated with the protein folding cycle.
15	PDB:7nvmA	0.659	0.699	4.699E-28	536	0.175	0.187	7nvmA.pdb.gz	Snapshots of actin and tubulin folding inside the TRiC chaperonin.
16	PDB:7nvme	0.648	0.682	5.718E-28	540	0.178	0.189	7nvme.pdb.gz	Snapshots of actin and tubulin folding inside the TRiC chaperonin.
17	PDB:7nvnZ	0.650	0.698	5.198E-27	529	0.197	0.214	7nvnZ.pdb.gz	Snapshots of actin and tubulin folding inside the TRiC chaperonin.
18	PDB:7nvnb	0.644	0.694	7.696E-27	527	0.215	0.233	7nvnb.pdb.gz	Snapshots of actin and tubulin folding inside the TRiC chaperonin.
19	PDB:7nvmH	0.640	0.688	8.916E-27	528	0.187	0.203	7nvmH.pdb.gz	Snapshots of actin and tubulin folding inside the TRiC chaperonin.
20	PDB:6ks6b	0.650	0.712	1.033E-26	518	0.192	0.212	6ks6b.pdb.gz	An ensemble of cryo-EM structures of TRiC reveal its conformational landscape and subunit specificity.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A024R3X4	1141	573	1.000	1.000	A0A024R3X4_HUMAN 60 kDa heat shock protein, mitochondrial (Fragment) OS=Homo sapiens OX=9606 GN=HSPD1 PE=2 SV=1
2	A0A0F6BAJ3	528	548	0.466	0.487	A0A0F6BAJ3_SALT1 Chaperonin GroEL OS=Salmonella typhimurium (strain 14028s / SGSC 2262) OX=588858 GN=groEL PE=1 SV=1
3	C5A1D5	529	548	0.466	0.487	CH60_ECOBW Chaperonin GroEL OS=Escherichia coli (strain K12 / MC4100 / BW2952) OX=595496 GN=groEL PE=1 SV=1
4	O02649	825	573	0.716	0.716	CH60A_DROME Heat shock protein 60A OS=Drosophila melanogaster OX=7227 GN=Hsp60A PE=1 SV=3
5	O66198	531	548	0.469	0.491	CH60_KLEAK Chaperonin GroEL OS=Klebsiella aerogenes (strain ATCC 13048 / DSM 30053 / CCUG 1429 / JCM 1235 / KCTC 2190 / NBRC 13534 / NCIMB 10102 / NCTC 10006 / CDC 819-56) OX=1028307 GN=groEL PE=3 SV=2
6	O74261	607	566	0.557	0.564	HSP60_CANAL Heat shock protein 60, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=HSP60 PE=3 SV=1
7	P0A6F5	529	548	0.466	0.487	CH60_ECOLI Chaperonin GroEL OS=Escherichia coli (strain K12) OX=83333 GN=groEL PE=1 SV=2
8	P10809	1141	573	1.000	1.000	CH60_HUMAN 60 kDa heat shock protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPD1 PE=1 SV=2
9	P19882	593	572	0.534	0.535	HSP60_YEAST Heat shock protein 60, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HSP60 PE=1 SV=1
10	P29185	646	577	0.567	0.563	CH61_MAIZE Chaperonin CPN60-1, mitochondrial OS=Zea mays OX=4577 GN=CPN60I PE=1 SV=2
11	P29197	637	577	0.567	0.563	CH60A_ARATH Chaperonin CPN60, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=CPN60 PE=1 SV=2
12	P31081	1112	573	0.972	0.972	CH60_BOVIN 60 kDa heat shock protein, mitochondrial OS=Bos taurus OX=9913 GN=HSPD1 PE=1 SV=2
13	P31681	547	544	0.492	0.518	CH601_CHLPN Chaperonin GroEL 1 OS=Chlamydia pneumoniae OX=83558 GN=groEL1 PE=2 SV=2
14	P50140	772	568	0.681	0.687	CH60_CAEEL Chaperonin homolog Hsp-60, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=hsp-60 PE=2 SV=2
15	P50142	593	590	0.539	0.524	HSP60_AJECA Heat shock protein 60, mitochondrial OS=Ajellomyces capsulatus OX=5037 GN=HSP60 PE=3 SV=2
16	P63038	1117	573	0.976	0.976	CH60_MOUSE 60 kDa heat shock protein, mitochondrial OS=Mus musculus OX=10090 GN=Hspd1 PE=1 SV=1
17	P63039	1117	573	0.976	0.976	CH60_RAT 60 kDa heat shock protein, mitochondrial OS=Rattus norvegicus OX=10116 GN=Hspd1 PE=1 SV=1
18	Q09864	617	582	0.539	0.531	HSP60_SCHPO Heat shock protein 60, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=hsp60 PE=1 SV=1
19	Q37683	563	562	0.499	0.509	CH60_TRYBB Chaperonin HSP60, mitochondrial OS=Trypanosoma brucei brucei OX=5702 GN=HSP60 PE=2 SV=2
20	Q4X1P0	612	587	0.553	0.540	Q4X1P0_ASPFU Antigenic mitochondrial protein HSP60, putative OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_2G09290 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00118 Cpn60_TCP1	6.3e-82	287.4	TCP-1/cpn60 chaperonin family
2	PF19962 EAD9	4.8e+02	11.9	Effector-associated domain 9

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000373620

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000233893	0.999	10 kDa heat shock protein, mitochondrial
2	9606.ENSP00000297185	0.999	Stress-70 protein, mitochondrial
3	9606.ENSP00000363089	0.999	Toll-like receptor 4
4	9606.ENSP00000260010	0.998	Toll-like receptor 2
5	9606.ENSP00000335153	0.998	Heat shock protein HSP 90-alpha
6	9606.ENSP00000360609	0.990	Heat shock protein HSP 90-beta
7	9606.ENSP00000385828	0.989	Thiosulfate sulfurtransferase
8	9606.ENSP00000264954	0.987	GrpE protein homolog 1, mitochondrial
9	9606.ENSP00000246957	0.986	Heat shock protein 75 kDa, mitochondrial
10	9606.ENSP00000396308	0.984	Dihydrofolate reductase
11	9606.ENSP00000324173	0.983	78 kDa glucose-regulated protein
12	9606.ENSP00000301046	0.980	Alpha-lactalbumin
13	9606.ENSP00000342056	0.977	Citrate synthase, mitochondrial
14	9606.ENSP00000362205	0.975	Triggering receptor expressed on myeloid cells 2
15	9606.ENSP00000302961	0.972	Heat shock protein family A member 4
16	9606.ENSP00000381736	0.969	ATP synthase subunit alpha, mitochondrial
17	9606.ENSP00000410339	0.969	Mitochondrial import receptor subunit TOM40 homolog
18	9606.ENSP00000296930	0.964	Nucleophosmin
19	9606.ENSP00000216254	0.963	Aconitate hydratase, mitochondrial
20	9606.ENSP00000360782	0.963	Mitochondrial-processing peptidase subunit alpha

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0051082	0.325	unfolded protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.988	cellular process
GO:0050896	0.944	response to stimulus
GO:0065007	0.807	biological regulation
GO:0050789	0.725	regulation of biological process
GO:0008152	0.679	metabolic process
GO:0050794	0.557	regulation of cellular process
GO:0071704	0.556	organic substance metabolic process
GO:0044238	0.494	primary metabolic process
GO:0044237	0.493	cellular metabolic process
GO:0006807	0.465	nitrogen compound metabolic process
GO:0006950	0.427	response to stress
GO:0048518	0.420	positive regulation of biological process
GO:0019222	0.382	regulation of metabolic process
GO:0071840	0.370	cellular component organization or biogenesis
GO:0060255	0.362	regulation of macromolecule metabolic process
GO:0043170	0.342	macromolecule metabolic process
GO:0016043	0.334	cellular component organization
GO:0048522	0.324	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0005739	0.990	mitochondrion
GO:0031974	0.941	membrane-enclosed lumen
GO:0070013	0.918	intracellular organelle lumen
GO:0016020	0.891	membrane
GO:0005634	0.809	nucleus
GO:0032991	0.712	protein-containing complex
GO:0005829	0.602	cytosol
GO:0005654	0.420	nucleoplasm
GO:0005576	0.413	extracellular region
GO:0012505	0.379	endomembrane system
GO:0005740	0.324	mitochondrial envelope

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]