StarFunc result for job id P10826

User Input

>input (455 residues)
MTTSGHACPVPAVNGHMTHYPATPYPLLFPPVIGGLSLPPLHGLHGHPPPSGCSTPSPAT
IETQSTSSEELVPSPPSPLPPPRVYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNM
IYTCHRDKNCVINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKETSKQECTESYEM
TAELDDLTEKIRKAHQETFPSLCQLGKYTTNSSADHRVRLDLGLWDKFSELATKCIIKIV
EFAKRLPGFTGLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNA
GFGPLTDLVFTFANQLLPLEMDDTETGLLSAICLICGDRQDLEEPTKVDKLQEPLLEALK
IYIRKRRPSKPHMFPKILMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGH
EPLTPSSSGNTAEHSPSISPSSVENSGVSQSPLVQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P22605	0.794	0.750	5.721E-62	482	0.978	0.923	P22605.pdb.gz	RARB_MOUSE Retinoic acid receptor beta OS=Mus musculus OX=10090 GN=Rarb PE=1 SV=1
2	AFDB:P22448	0.565	0.565	1.237E-60	455	0.952	0.952	P22448.pdb.gz	RARB_CHICK Retinoic acid receptor beta OS=Gallus gallus OX=9031 GN=RARB PE=2 SV=2
3	AFDB:F1D8S6	0.785	0.797	1.495E-57	448	0.886	0.900	F1D8S6.pdb.gz	F1D8S6_HUMAN Retinoic acid receptor beta variant 1 OS=Homo sapiens OX=9606 GN=NR1B2 PE=2 SV=1
4	AFDB:A0A0G2JW78	0.555	0.547	1.206E-53	462	0.802	0.790	A0A0G2JW78.pdb.gz	A0A0G2JW78_RAT Retinoic acid receptor, alpha OS=Rattus norvegicus OX=10116 GN=Rara PE=3 SV=1
5	AFDB:D3ZF61	0.785	0.780	4.098E-52	458	0.727	0.723	D3ZF61.pdb.gz	D3ZF61_RAT Retinoic acid receptor, gamma OS=Rattus norvegicus OX=10116 GN=Rarg PE=3 SV=1
6	AFDB:F1D8N9	0.548	0.546	5.375E-52	457	0.749	0.746	F1D8N9.pdb.gz	F1D8N9_HUMAN Retinoic acid nuclear receptor alpha variant 2 OS=Homo sapiens OX=9606 GN=NR1B1 PE=2 SV=1
7	AFDB:Q7ZTI3	0.543	0.540	6.441E-52	458	0.738	0.734	Q7ZTI3.pdb.gz	RARAB_DANRE Retinoic acid receptor alpha-B OS=Danio rerio OX=7955 GN=rarab PE=2 SV=1
8	AFDB:Q90271	0.549	0.562	1.906E-51	444	0.734	0.752	Q90271.pdb.gz	RARAA_DANRE Retinoic acid receptor alpha-A OS=Danio rerio OX=7955 GN=raraa PE=2 SV=2
9	AFDB:A8MUP8	0.552	0.526	4.300E-51	478	0.747	0.711	A8MUP8.pdb.gz	A8MUP8_HUMAN Retinoic acid receptor alpha OS=Homo sapiens OX=9606 GN=RARA PE=1 SV=1
10	AFDB:Q15156	0.743	0.428	2.507E-50	797	0.725	0.414	Q15156.pdb.gz	Q15156_HUMAN PML-RAR protein OS=Homo sapiens OX=9606 GN=PML-RAR PE=1 SV=1
11	PDB:6fx0A	0.518	0.986	3.808E-30	238	0.457	0.874	6fx0A.pdb.gz	Structure-based design of Trifarotene (CD5789), a potent and selective RAR gamma agonist for the treatment of acne.
12	PDB:3dzyA	0.421	0.623	7.068E-19	302	0.240	0.361	3dzyA.pdb.gz	Structure of the intact PPAR-gamma-RXR- nuclear receptor complex on DNA.
13	PDB:1g2nA	0.376	0.669	1.572E-7	246	0.132	0.244	1g2nA.pdb.gz	Crystal structure of the ligand-binding domain of the ultraspiracle protein USP, the ortholog of retinoid X receptors in insects.
14	PDB:7kw7F	0.368	0.615	6.716E-5	259	0.079	0.139	7kw7F.pdb.gz	Structure of Hsp90-Hsp70-Hop-GR reveals the Hsp90 client-loading mechanism.
15	PDB:2jcdA	0.120	0.150	6.492E-1	315	0.068	0.098	2jcdA.pdb.gz	Structure and Action of the N-Oxygenase Aurf from Streptomyces Thioluteus.
16	PDB:1ggqA	0.083	0.179	8.138E-1	162	0.048	0.136	1ggqA.pdb.gz
17	PDB:3zqeB	0.095	0.154	8.515E-1	248	0.073	0.133	3zqeB.pdb.gz	Crystal Structure of Prgi-Sipd: Insight Into a Secretion Competent State of the Type Three Secretion System Needle Tip and its Interaction with Host Ligands
18	PDB:1ekuB	0.089	0.141	1.020	254	0.070	0.126	1ekuB.pdb.gz
19	PDB:2j0oA	0.093	0.113	1.020	284	0.075	0.120	2j0oA.pdb.gz
20	PDB:1szqA	0.093	0.091	1.067	473	0.057	0.055	1szqA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JW78	698	462	0.774	0.762	A0A0G2JW78_RAT Retinoic acid receptor, alpha OS=Rattus norvegicus OX=10116 GN=Rara PE=3 SV=1
2	A0A8I6A7Z0	922	455	0.978	0.978	A0A8I6A7Z0_RAT Retinoic acid receptor, beta OS=Rattus norvegicus OX=10116 GN=Rarb PE=3 SV=1
3	A0A8I6AIB6	806	408	0.857	0.956	A0A8I6AIB6_RAT Retinoic acid receptor, beta OS=Rattus norvegicus OX=10116 GN=Rarb PE=3 SV=1
4	A2T928	630	489	0.692	0.644	RARGB_DANRE Retinoic acid receptor gamma-B OS=Danio rerio OX=7955 GN=rargb PE=2 SV=1
5	A8K3H3	617	454	0.716	0.718	A8K3H3_HUMAN Retinoic acid nuclear receptor gamma variant 1 OS=Homo sapiens OX=9606 GN=RARG PE=2 SV=1
6	A8MUP8	649	478	0.710	0.676	A8MUP8_HUMAN Retinoic acid receptor alpha OS=Homo sapiens OX=9606 GN=RARA PE=1 SV=1
7	D3ZF61	616	458	0.730	0.725	D3ZF61_RAT Retinoic acid receptor, gamma OS=Rattus norvegicus OX=10116 GN=Rarg PE=3 SV=1
8	D3ZFD9	808	448	0.857	0.871	D3ZFD9_RAT Retinoic acid receptor, beta OS=Rattus norvegicus OX=10116 GN=Rarb PE=3 SV=2
9	D3ZWV0	607	485	0.695	0.652	D3ZWV0_RAT Retinoic acid receptor, gamma OS=Rattus norvegicus OX=10116 GN=Rarg PE=3 SV=1
10	E7BBH7	630	502	0.686	0.622	E7BBH7_ONCMY Retinoic acid receptor, gamma, variant a OS=Oncorhynchus mykiss OX=8022 GN=rarg a PE=2 SV=1
11	F1D8N9	645	457	0.716	0.713	F1D8N9_HUMAN Retinoic acid nuclear receptor alpha variant 2 OS=Homo sapiens OX=9606 GN=NR1B1 PE=2 SV=1
12	F1D8S6	816	448	0.868	0.882	F1D8S6_HUMAN Retinoic acid receptor beta variant 1 OS=Homo sapiens OX=9606 GN=NR1B2 PE=2 SV=1
13	P10276	695	462	0.767	0.755	RARA_HUMAN Retinoic acid receptor alpha OS=Homo sapiens OX=9606 GN=RARA PE=1 SV=2
14	P10826	939	455	1.000	1.000	RARB_HUMAN Retinoic acid receptor beta OS=Homo sapiens OX=9606 GN=RARB PE=1 SV=2
15	P11416	697	462	0.769	0.758	RARA_MOUSE Retinoic acid receptor alpha OS=Mus musculus OX=10090 GN=Rara PE=1 SV=1
16	P13631	617	454	0.716	0.718	RARG_HUMAN Retinoic acid receptor gamma OS=Homo sapiens OX=9606 GN=RARG PE=1 SV=1
17	P18911	619	458	0.719	0.714	RARG_MOUSE Retinoic acid receptor gamma OS=Mus musculus OX=10090 GN=Rarg PE=1 SV=3
18	P22448	877	455	0.952	0.952	RARB_CHICK Retinoic acid receptor beta OS=Gallus gallus OX=9031 GN=RARB PE=2 SV=2
19	P22605	908	482	0.978	0.923	RARB_MOUSE Retinoic acid receptor beta OS=Mus musculus OX=10090 GN=Rarb PE=1 SV=1
20	P51126	658	458	0.738	0.734	RARA_XENLA Retinoic acid receptor alpha OS=Xenopus laevis OX=8355 GN=rara PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00104 Hormone_recep	1.6e-19	81.9	Ligand-binding domain of nuclear hormone receptor
2	PF00105 zf-C4	6e-29	111.6	Zinc finger, C4 type (two domains)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9593.ENSGGOP00000002296

Rank	PPI partner	STRING score	Description
1	9593.ENSGGOP00000009529	0.994	Retinoid X receptor, alpha
2	9593.ENSGGOP00000009599	0.971	Retinoid X receptor, beta
3	9593.ENSGGOP00000011007	0.968	Nuclear receptor coactivator 1
4	9593.ENSGGOP00000003909	0.965	Retinoid X receptor, gamma
5	9593.ENSGGOP00000023853	0.873	Nuclear receptor coactivator 2
6	9593.ENSGGOP00000011787	0.864	Nuclear receptor interacting protein 1
7	9593.ENSGGOP00000009200	0.860	Nuclear receptor corepressor 2
8	9593.ENSGGOP00000023665	0.823	Mediator of RNA polymerase II transcription subunit 1
9	9593.ENSGGOP00000002450	0.794	Cellular retinoic acid binding protein 2
10	9593.ENSGGOP00000002097	0.778	Uncharacterized protein
11	9593.ENSGGOP00000019561	0.778	Uncharacterized protein
12	9593.ENSGGOP00000000584	0.770	Uncharacterized protein
13	9593.ENSGGOP00000001635	0.770	Uncharacterized protein
14	9593.ENSGGOP00000016336	0.770	Uncharacterized protein
15	9593.ENSGGOP00000028174	0.770	Uncharacterized protein
16	9593.ENSGGOP00000020086	0.751	Belongs to the acetyltransferase family. GCN5 subfamily.
17	9593.ENSGGOP00000005899	0.741	CREB binding protein
18	9593.ENSGGOP00000008032	0.741	E1A binding protein p300
19	9593.ENSGGOP00000011454	0.721	Histone deacetylase 1
20	9593.ENSGGOP00000008724	0.717	Uncharacterized protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008134	0.999	transcription factor binding
GO:0003677	0.999	DNA binding
GO:0060089	0.997	molecular transducer activity
GO:0000981	0.996	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0098531	0.988	ligand-activated transcription factor activity
GO:0043565	0.987	sequence-specific DNA binding
GO:0004879	0.981	nuclear receptor activity
GO:0003690	0.921	double-stranded DNA binding
GO:1990837	0.910	sequence-specific double-stranded DNA binding
GO:0000976	0.814	transcription cis-regulatory region binding
GO:0140297	0.782	DNA-binding transcription factor binding
GO:0016922	0.750	nuclear receptor binding
GO:0042974	0.732	nuclear retinoic acid receptor binding
GO:0000977	0.405	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0046965	0.366	nuclear retinoid X receptor binding
GO:0043167	0.327	ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.990	regulation of cellular process
GO:0009987	0.980	cellular process
GO:0051239	0.955	regulation of multicellular organismal process
GO:0032501	0.933	multicellular organismal process
GO:0048856	0.931	anatomical structure development
GO:0050896	0.925	response to stimulus
GO:0007275	0.901	multicellular organism development
GO:0048522	0.897	positive regulation of cellular process
GO:0050793	0.848	regulation of developmental process
GO:2000026	0.811	regulation of multicellular organismal development
GO:0048731	0.806	system development
GO:0060255	0.796	regulation of macromolecule metabolic process
GO:0048513	0.787	animal organ development
GO:0042127	0.762	regulation of cell population proliferation
GO:0010468	0.739	regulation of gene expression
GO:0042221	0.714	response to chemical
GO:0051094	0.704	positive regulation of developmental process
GO:0010033	0.687	response to organic substance
GO:0033993	0.680	response to lipid
GO:1901700	0.655	response to oxygen-containing compound
GO:0080090	0.653	regulation of primary metabolic process
GO:0031323	0.652	regulation of cellular metabolic process
GO:0051171	0.636	regulation of nitrogen compound metabolic process
GO:0010556	0.632	regulation of macromolecule biosynthetic process
GO:0031326	0.632	regulation of cellular biosynthetic process
GO:0009653	0.630	anatomical structure morphogenesis
GO:0019219	0.625	regulation of nucleobase-containing compound metabolic process
GO:0031641	0.623	regulation of myelination
GO:0006355	0.619	regulation of DNA-templated transcription
GO:0051240	0.607	positive regulation of multicellular organismal process
GO:0008284	0.578	positive regulation of cell population proliferation
GO:0061351	0.576	neural precursor cell proliferation
GO:0032526	0.528	response to retinoic acid
GO:0051716	0.465	cellular response to stimulus
GO:0048523	0.451	negative regulation of cellular process
GO:0071704	0.445	organic substance metabolic process
GO:0044237	0.445	cellular metabolic process
GO:0044238	0.443	primary metabolic process
GO:0023052	0.429	signaling
GO:0070887	0.414	cellular response to chemical stimulus
GO:0007154	0.412	cell communication
GO:0006357	0.394	regulation of transcription by RNA polymerase II
GO:0006807	0.380	nitrogen compound metabolic process
GO:0010604	0.371	positive regulation of macromolecule metabolic process
GO:0007165	0.371	signal transduction
GO:0031325	0.351	positive regulation of cellular metabolic process
GO:0051173	0.327	positive regulation of nitrogen compound metabolic process
GO:0043170	0.325	macromolecule metabolic process
GO:0071310	0.325	cellular response to organic substance
GO:0010605	0.306	negative regulation of macromolecule metabolic process
GO:0031324	0.306	negative regulation of cellular metabolic process
GO:0051172	0.305	negative regulation of nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.997	nucleoplasm
GO:0043232	0.938	intracellular non-membrane-bounded organelle
GO:0032991	0.877	protein-containing complex
GO:0005737	0.817	cytoplasm
GO:0005829	0.316	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]