StarFunc result for job id P10827

User Input

>input (490 residues)
MEQKPSKVECGSDPEENSARSPDGKRKRKNGQCSLKTSMSGYIPSYLDKDEQCVVCGDKA
TGYHYRCITCEGCKGFFRRTIQKNLHPTYSCKYDSCCVIDKITRNQCQLCRFKKCIAVGM
AMDLVLDDSKRVAKRKLIEQNRERRRKEEMIRSLQQRPEPTPEEWDLIHIATEAHRSTNA
QGSHWKQRRKFLPDDIGQSPIVSMPDGDKVDLEAFSEFTKIITPAITRVVDFAKKLPMFS
ELPCEDQIILLKGCCMEIMSLRAAVRYDPESDTLTLSGEMAVKREQLKNGGLGVVSDAIF
ELGKSLSAFNLDDTEVALLQAVLLMSTDRSGLLCVDKIEKSQEAYLLAFEHYVNHRKHNI
PHFWPKLLMKEREVQSSILYKGAAAEGRPGGSLGVHPEGQQLLGMHVVQGPQVRQLEQQL
GEAGSLQGPVLQHQSPKSPQQRLLELLHRSGILHARAVCGEDDSSEADSPSSSEEEPEVC
EDLAGNAASP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P63058	0.711	0.709	1.244E-64	492	0.976	0.972	P63058.pdb.gz	THA_MOUSE Thyroid hormone receptor alpha OS=Mus musculus OX=10090 GN=Thra PE=1 SV=2
2	AFDB:P15204	0.471	0.548	1.702E-47	418	0.659	0.773	P15204.pdb.gz	THAA_XENLA Thyroid hormone receptor alpha-A OS=Xenopus laevis OX=8355 GN=thra-a PE=1 SV=3
3	AFDB:Q98867	0.468	0.534	8.160E-46	427	0.629	0.721	Q98867.pdb.gz	THAA_DANRE Thyroid hormone receptor alpha-A OS=Danio rerio OX=7955 GN=thraa PE=1 SV=1
4	AFDB:F1NWE9	0.618	0.634	5.924E-45	476	0.567	0.584	F1NWE9.pdb.gz	F1NWE9_CHICK Thyroid hormone receptor beta OS=Gallus gallus OX=9031 GN=THRB PE=3 SV=2
5	AFDB:A0A024R2I8	0.632	0.669	1.159E-43	461	0.571	0.607	A0A024R2I8.pdb.gz	A0A024R2I8_HUMAN Thyroid hormone nuclear receptor beta variant 1 OS=Homo sapiens OX=9606 GN=NR1A2 PE=2 SV=1
6	AFDB:P18119	0.659	0.775	1.215E-43	414	0.563	0.667	P18119.pdb.gz	THBB_XENLA Thyroid hormone receptor beta-B OS=Xenopus laevis OX=8355 GN=thrb-b PE=2 SV=1
7	AFDB:Q9PVE4	0.591	0.718	1.790E-42	395	0.545	0.676	Q9PVE4.pdb.gz	THB_DANRE Thyroid hormone receptor beta OS=Danio rerio OX=7955 GN=thrb PE=1 SV=2
8	AFDB:E7BBH7	0.429	0.419	1.151E-25	502	0.296	0.289	E7BBH7.pdb.gz	E7BBH7_ONCMY Retinoic acid receptor, gamma, variant a OS=Oncorhynchus mykiss OX=8022 GN=rarg a PE=2 SV=1
9	AFDB:Q91392	0.436	0.429	6.294E-25	499	0.276	0.271	Q91392.pdb.gz	RARGA_DANRE Retinoic acid receptor gamma-A OS=Danio rerio OX=7955 GN=rarga PE=1 SV=2
10	AFDB:F1D8N9	0.427	0.456	9.182E-25	457	0.302	0.324	F1D8N9.pdb.gz	F1D8N9_HUMAN Retinoic acid nuclear receptor alpha variant 2 OS=Homo sapiens OX=9606 GN=NR1B1 PE=2 SV=1
11	PDB:3dzyA	0.343	0.540	1.460E-14	302	0.180	0.291	3dzyA.pdb.gz	Structure of the intact PPAR-gamma-RXR- nuclear receptor complex on DNA.
12	PDB:6fx0A	0.426	0.842	3.752E-14	238	0.155	0.319	6fx0A.pdb.gz	Structure-based design of Trifarotene (CD5789), a potent and selective RAR gamma agonist for the treatment of acne.
13	PDB:1g2nA	0.373	0.706	8.175E-7	246	0.100	0.199	1g2nA.pdb.gz	Crystal structure of the ligand-binding domain of the ultraspiracle protein USP, the ortholog of retinoid X receptors in insects.
14	PDB:7kw7F	0.303	0.544	2.589E-4	259	0.067	0.127	7kw7F.pdb.gz	Structure of Hsp90-Hsp70-Hop-GR reveals the Hsp90 client-loading mechanism.
15	PDB:1szqA	0.090	0.092	6.860E-1	473	0.047	0.049	1szqA.pdb.gz
16	PDB:5x3xQ	0.082	0.127	8.286E-1	243	0.088	0.177	5x3xQ.pdb.gz
17	PDB:6g1qB	0.100	0.128	9.106E-1	331	0.051	0.076	6g1qB.pdb.gz	(ADP-ribosyl)hydrolases: Structural Basis for Differential Substrate Recognition and Inhibition.
18	PDB:6gmlU	0.075	0.156	1.001	183	0.059	0.158	6gmlU.pdb.gz	Structure of paused transcription complex Pol II-DSIF-NELF.
19	PDB:1jqiA	0.066	0.078	1.049	384	0.047	0.060	1jqiA.pdb.gz	Crystal structure of rat short chain acyl-CoA dehydrogenase complexed with acetoacetyl-CoA: comparison with other acyl-CoA dehydrogenases.
20	PDB:6g79S	0.109	0.165	1.209	262	0.047	0.088	6g79S.pdb.gz	Cryo-EM structure of the serotonin 5-HT1Breceptor coupled to heterotrimeric Go.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A024R2I8	0.0	567	461	0.557	0.592	A0A024R2I8_HUMAN Thyroid hormone nuclear receptor beta variant 1 OS=Homo sapiens OX=9606 GN=NR1A2 PE=2 SV=1
2	F1NWE9	0.0	573	476	0.561	0.578	F1NWE9_CHICK Thyroid hormone receptor beta OS=Gallus gallus OX=9031 GN=THRB PE=3 SV=2
3	P04625	0.0	672	408	0.671	0.806	THA_CHICK Thyroid hormone receptor alpha OS=Gallus gallus OX=9031 GN=THRA PE=1 SV=1
4	P10827	0.0	1014	490	1.000	1.000	THA_HUMAN Thyroid hormone receptor alpha OS=Homo sapiens OX=9606 GN=THRA PE=1 SV=1
5	P10828	0.0	567	461	0.557	0.592	THB_HUMAN Thyroid hormone receptor beta OS=Homo sapiens OX=9606 GN=THRB PE=1 SV=2
6	P15204	0.0	676	418	0.657	0.770	THAA_XENLA Thyroid hormone receptor alpha-A OS=Xenopus laevis OX=8355 GN=thra-a PE=1 SV=3
7	P18113	0.0	561	461	0.549	0.584	THB_RAT Thyroid hormone receptor beta OS=Rattus norvegicus OX=10116 GN=Thrb PE=1 SV=2
8	P18115	0.0	674	418	0.657	0.770	THAB_XENLA Thyroid hormone receptor alpha-B OS=Xenopus laevis OX=8355 GN=thra-b PE=1 SV=2
9	P18117	0.0	598	373	0.569	0.748	THBA_XENLA Thyroid hormone receptor beta-A OS=Xenopus laevis OX=8355 GN=thrb-a PE=1 SV=1
10	P18119	0.0	591	414	0.563	0.667	THBB_XENLA Thyroid hormone receptor beta-B OS=Xenopus laevis OX=8355 GN=thrb-b PE=2 SV=1
11	P37242	0.0	562	461	0.551	0.586	THB_MOUSE Thyroid hormone receptor beta OS=Mus musculus OX=10090 GN=Thrb PE=1 SV=1
12	P63058	0.0	986	492	0.976	0.972	THA_MOUSE Thyroid hormone receptor alpha OS=Mus musculus OX=10090 GN=Thra PE=1 SV=2
13	P63059	0.0	985	492	0.973	0.970	THA_RAT Thyroid hormone receptor alpha OS=Rattus norvegicus OX=10116 GN=Thra PE=1 SV=1
14	P68306	0.0	574	369	0.565	0.751	THB_CHICK Thyroid hormone receptor beta OS=Gallus gallus OX=9031 GN=THRB PE=1 SV=1
15	Q98867	0.0	632	427	0.610	0.700	THAA_DANRE Thyroid hormone receptor alpha-A OS=Danio rerio OX=7955 GN=thraa PE=1 SV=1
16	Q9PVE4	0.0	552	395	0.545	0.676	THB_DANRE Thyroid hormone receptor beta OS=Danio rerio OX=7955 GN=thrb PE=1 SV=2
17	P22448	8.72e-70	231	455	0.261	0.281	RARB_CHICK Retinoic acid receptor beta OS=Gallus gallus OX=9031 GN=RARB PE=2 SV=2
18	Q90966	3.38e-69	230	460	0.257	0.274	RARA_CHICK Retinoic acid receptor alpha OS=Gallus gallus OX=9031 GN=RARA PE=2 SV=1
19	A0A8I6AIB6	7.76e-69	227	408	0.261	0.314	A0A8I6AIB6_RAT Retinoic acid receptor, beta OS=Rattus norvegicus OX=10116 GN=Rarb PE=3 SV=1
20	P10826	1.35e-68	228	455	0.259	0.279	RARB_HUMAN Retinoic acid receptor beta OS=Homo sapiens OX=9606 GN=RARB PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13060 DUF3921	3.9e+02	12.5	Protein of unknown function (DUF3921)
2	PF00104 Hormone_recep	2.7e-13	61.5	Ligand-binding domain of nuclear hormone receptor
3	PF00105 zf-C4	4.7e-26	102.4	Zinc finger, C4 type (two domains)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000264637

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000268712	0.997	Nuclear receptor corepressor 1
2	9606.ENSP00000385216	0.992	Nuclear receptor coactivator 1
3	9606.ENSP00000384018	0.988	Nuclear receptor corepressor 2
4	9606.ENSP00000419692	0.980	Retinoic acid receptor RXR-alpha
5	9606.ENSP00000300651	0.966	Mediator of RNA polymerase II transcription subunit 1
6	9606.ENSP00000428056	0.958	Phosphatidylinositol 3-kinase regulatory subunit alpha
7	9606.ENSP00000348056	0.928	SUMO-conjugating enzyme UBC9
8	9606.ENSP00000254066	0.913	Retinoic acid receptor alpha
9	9606.ENSP00000409666	0.908	Small ubiquitin-like modifier 3
10	9606.ENSP00000332296	0.906	Retinoic acid receptor beta
11	9606.ENSP00000388510	0.906	Retinoic acid receptor gamma
12	9606.ENSP00000379904	0.905	Thyroid hormone receptor beta
13	9606.ENSP00000465676	0.903	E3 SUMO-protein ligase PIAS2
14	9606.ENSP00000377686	0.902	Mediator of RNA polymerase II transcription subunit 24
15	9606.ENSP00000352900	0.882	Retinoic acid receptor RXR-gamma
16	9606.ENSP00000363817	0.881	Retinoic acid receptor RXR-beta
17	9606.ENSP00000383063	0.878	Nuclear receptor-interacting protein 1
18	9606.ENSP00000222254	0.852	Phosphatidylinositol 3-kinase regulatory subunit beta
19	9606.ENSP00000262741	0.849	Phosphatidylinositol 3-kinase regulatory subunit gamma
20	9606.ENSP00000361066	0.846	Nuclear receptor coactivator 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0004879	0.999	nuclear receptor activity
GO:0000976	0.997	transcription cis-regulatory region binding
GO:0044877	0.743	protein-containing complex binding
GO:0003682	0.708	chromatin binding
GO:0008134	0.616	transcription factor binding
GO:0140297	0.307	DNA-binding transcription factor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0048518	0.993	positive regulation of biological process
GO:0060255	0.991	regulation of macromolecule metabolic process
GO:0009889	0.986	regulation of biosynthetic process
GO:0019219	0.986	regulation of nucleobase-containing compound metabolic process
GO:0009987	0.982	cellular process
GO:0048522	0.981	positive regulation of cellular process
GO:0006357	0.977	regulation of transcription by RNA polymerase II
GO:0009893	0.971	positive regulation of metabolic process
GO:0010604	0.932	positive regulation of macromolecule metabolic process
GO:0031325	0.929	positive regulation of cellular metabolic process
GO:0045935	0.918	positive regulation of nucleobase-containing compound metabolic process
GO:0045893	0.914	positive regulation of DNA-templated transcription
GO:0050896	0.894	response to stimulus
GO:0071704	0.848	organic substance metabolic process
GO:0045944	0.834	positive regulation of transcription by RNA polymerase II
GO:0044238	0.789	primary metabolic process
GO:0044237	0.739	cellular metabolic process
GO:0006807	0.712	nitrogen compound metabolic process
GO:0043170	0.636	macromolecule metabolic process
GO:0032501	0.581	multicellular organismal process
GO:0032502	0.543	developmental process
GO:0048519	0.475	negative regulation of biological process
GO:0048523	0.474	negative regulation of cellular process
GO:0051716	0.470	cellular response to stimulus
GO:0042221	0.458	response to chemical
GO:1901360	0.440	organic cyclic compound metabolic process
GO:0007154	0.407	cell communication
GO:0006725	0.391	cellular aromatic compound metabolic process
GO:0034641	0.374	cellular nitrogen compound metabolic process
GO:0006351	0.359	DNA-templated transcription
GO:0048856	0.349	anatomical structure development
GO:0048583	0.329	regulation of response to stimulus
GO:0010605	0.325	negative regulation of macromolecule metabolic process
GO:0051172	0.323	negative regulation of nitrogen compound metabolic process
GO:0023052	0.306	signaling
GO:0007165	0.304	signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.997	nucleoplasm
GO:0005829	0.996	cytosol
GO:0032991	0.994	protein-containing complex
GO:0005667	0.889	transcription regulator complex
GO:0140513	0.875	nuclear protein-containing complex
GO:0090575	0.799	RNA polymerase II transcription regulator complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]