StarFunc result for job id P10909

User Input

>input (449 residues)
MMKTLLLFVGLLLTWESGQVLGDQTVSDNELQEMSNQGSKYVNKEIQNAVNGVKQIKTLI
EKTNEERKTLLSNLEEAKKKKEDALNETRESETKLKELPGVCNETMMALWEECKPCLKQT
CMKFYARVCRSGSGLVGRQLEEFLNQSSPFYFWMNGDRIDSLLENDRQQTHMLDVMQDHF
SRASSIIDELFQDRFFTREPQDTYHYLPFSLPHRRPHFFFPKSRIVRSLMPFSPYEPLNF
HAMFQPFLEMIHEAQQAMDIHFHSPAFQHPPTEFIREGDDDRTVCREIRHNSTGCLRMKD
QCDKCREILSVDCSTNNPSQAKLRRELDESLQVAERLTRKYNELLKSYQWKMLNTSSLLE
QLNEQFNWVSRLANLTQGEDQYYLRVTTVASHTSDSDVPSGVTEVVVKLFDSDPITVTVP
VEVSRKNPKFMETVAEKALQEYRKKHREE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P10909	1.000	1.000	2.517E-61	449	1.000	1.000	P10909.pdb.gz	CLUS_HUMAN Clusterin OS=Homo sapiens OX=9606 GN=CLU PE=1 SV=1
2	AFDB:Q06890	0.880	0.882	8.449E-47	448	0.764	0.766	Q06890.pdb.gz	CLUS_MOUSE Clusterin OS=Mus musculus OX=10090 GN=Clu PE=1 SV=1
3	AFDB:P25473	0.785	0.792	7.235E-46	445	0.782	0.789	P25473.pdb.gz	CLUS_CANLF Clusterin OS=Canis lupus familiaris OX=9615 GN=CLU PE=2 SV=1
4	AFDB:Q29549	0.789	0.793	3.718E-42	446	0.717	0.722	Q29549.pdb.gz	CLUS_PIG Clusterin OS=Sus scrofa OX=9823 GN=CLU PE=1 SV=1
5	AFDB:Q9YGP0	0.721	0.722	4.243E-29	448	0.459	0.460	Q9YGP0.pdb.gz	Q9YGP0_CHICK Clusterin OS=Gallus gallus OX=9031 PE=2 SV=1
6	AFDB:A0A0B5JQ03	0.543	0.543	4.485E-27	449	0.399	0.399	A0A0B5JQ03.pdb.gz
7	AFDB:E7ETB4	0.445	0.674	6.126E-24	271	0.601	0.996	E7ETB4.pdb.gz	E7ETB4_HUMAN Clusterin (Fragment) OS=Homo sapiens OX=9606 GN=CLU PE=1 SV=1
8	AFDB:Q32KZ9	0.129	0.136	1.987E-2	418	0.129	0.139	Q32KZ9.pdb.gz	TEKT1_BOVIN Tektin-1 OS=Bos taurus OX=9913 GN=TEKT1 PE=1 SV=1
9	AFDB:Q2TV77	0.193	0.146	2.863E-2	616	0.073	0.054	Q2TV77.pdb.gz	Q2TV77_FINMA Adhesion factor OS=Finegoldia magna OX=1260 GN=faf PE=1 SV=1
10	AFDB:Q969V4	0.140	0.147	3.137E-2	418	0.129	0.139	Q969V4.pdb.gz	TEKT1_HUMAN Tektin-1 OS=Homo sapiens OX=9606 GN=TEKT1 PE=1 SV=1
11	PDB:7rroA1	0.151	0.167	3.975E-2	396	0.122	0.139	7rroA1.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
12	PDB:7p5jA	0.230	0.249	4.355E-2	399	0.094	0.105	7p5jA.pdb.gz
13	PDB:7ungA1	0.154	0.171	7.200E-2	391	0.107	0.123	7ungA1.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.
14	PDB:7p5cA	0.107	0.121	8.258E-2	392	0.098	0.112	7p5cA.pdb.gz
15	PDB:7rroA3	0.164	0.204	8.258E-2	334	0.122	0.165	7rroA3.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
16	PDB:7ungA3	0.150	0.187	8.644E-2	333	0.111	0.150	7ungA3.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.
17	PDB:7rroF1	0.200	0.208	2.256E-1	421	0.116	0.124	7rroF1.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
18	PDB:7yymA	0.100	0.038	2.362E-1	1281	0.042	0.015	7yymA.pdb.gz	Structural and functional basis of mammalian microRNA biogenesis by Dicer.
19	PDB:7p54A	0.104	0.116	2.968E-1	397	0.089	0.101	7p54A.pdb.gz
20	PDB:6xz6A	0.135	0.259	6.454E-1	213	0.078	0.164	6xz6A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E7ETB4	0.0	535	271	0.604	1.000	E7ETB4_HUMAN Clusterin (Fragment) OS=Homo sapiens OX=9606 GN=CLU PE=1 SV=1
2	H0YLK8	0.0	605	297	0.637	0.963	H0YLK8_HUMAN Clusterin (Fragment) OS=Homo sapiens OX=9606 GN=CLU PE=1 SV=1
3	P05371	0.0	716	447	0.748	0.752	CLUS_RAT Clusterin OS=Rattus norvegicus OX=10116 GN=Clu PE=1 SV=2
4	P10909	0.0	940	449	1.000	1.000	CLUS_HUMAN Clusterin OS=Homo sapiens OX=9606 GN=CLU PE=1 SV=1
5	P25473	0.0	714	445	0.782	0.789	CLUS_CANLF Clusterin OS=Canis lupus familiaris OX=9615 GN=CLU PE=2 SV=1
6	Q06890	0.0	715	448	0.744	0.746	CLUS_MOUSE Clusterin OS=Mus musculus OX=10090 GN=Clu PE=1 SV=1
7	Q29549	0.0	649	446	0.717	0.722	CLUS_PIG Clusterin OS=Sus scrofa OX=9823 GN=CLU PE=1 SV=1
8	E7ERK6	1.75e-149	425	204	0.454	1.000	E7ERK6_HUMAN Clusterin (Fragment) OS=Homo sapiens OX=9606 GN=CLU PE=1 SV=1
9	Q9YGP0	4.47e-132	390	448	0.454	0.455	Q9YGP0_CHICK Clusterin OS=Gallus gallus OX=9031 PE=2 SV=1
10	Q6PBL3	1.84e-107	327	448	0.392	0.393	Q6PBL3_DANRE Clusterin OS=Danio rerio OX=7955 GN=zgc:73352 PE=2 SV=1
11	Q6PTX2	2.91e-15	72.4	69	0.078	0.507	Q6PTX2_CHICK Clusterin (Fragment) OS=Gallus gallus OX=9031 GN=CLU PE=3 SV=1
12	Q99NH0	1.5	33.9	2603	0.042	0.007	ANR17_MOUSE Ankyrin repeat domain-containing protein 17 OS=Mus musculus OX=10090 GN=Ankrd17 PE=1 SV=2
13	H0YM23	1.7	33.9	2487	0.042	0.008	H0YM23_HUMAN Ankyrin repeat domain 17 (Fragment) OS=Homo sapiens OX=9606 GN=ANKRD17 PE=1 SV=1
14	O75179	1.7	33.9	2603	0.042	0.007	ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens OX=9606 GN=ANKRD17 PE=1 SV=3
15	Q8CG76	1.8	33.1	367	0.051	0.063	ARK72_MOUSE Aflatoxin B1 aldehyde reductase member 2 OS=Mus musculus OX=10090 GN=Akr7a2 PE=1 SV=3
16	O14093	4.4	32.3	949	0.042	0.020	VPS54_SCHPO Vacuolar protein sorting-associated protein 54 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=vps54 PE=1 SV=1
17	A0A0G2JXN2	7.1	31.6	759	0.062	0.037	TRI46_RAT Tripartite motif-containing protein 46 OS=Rattus norvegicus OX=10116 GN=Trim46 PE=1 SV=2
18	Q7TNM2	7.3	31.6	759	0.062	0.037	TRI46_MOUSE Tripartite motif-containing protein 46 OS=Mus musculus OX=10090 GN=Trim46 PE=1 SV=1
19	O35412	9.6	31.2	1822	0.045	0.011	SI1L1_RAT Signal-induced proliferation-associated 1-like protein 1 OS=Rattus norvegicus OX=10116 GN=Sipa1l1 PE=1 SV=1
20	Q9U8L5	9.9	30.8	391	0.024	0.028	Q9U8L5_DROME Dorsocross1, isoform A OS=Drosophila melanogaster OX=7227 GN=Doc1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07464 ApoLp-III	23	16.6	Apolipophorin-III precursor (apoLp-III)
2	PF01093 Clusterin	2e-155	529.7	Clusterin
3	PF05659 RPW8	5.3e+02	11.6	Arabidopsis broad-spectrum mildew resistance protein RPW8
4	PF16533 SOAR	1.9e+02	13.4	STIM1 Orai1-activating region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000315130

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000352257	0.997	X-ray repair cross-complementing protein 6
2	9606.ENSP00000263816	0.996	Low-density lipoprotein receptor-related protein 2
3	9606.ENSP00000236850	0.995	Apolipoprotein A-I
4	9606.ENSP00000284981	0.988	Amyloid-beta A4 protein
5	9606.ENSP00000252486	0.987	Apolipoprotein E
6	9606.ENSP00000231751	0.984	Lactotransferrin
7	9606.ENSP00000324173	0.974	78 kDa glucose-regulated protein
8	9606.ENSP00000302564	0.972	Bcl-2-like protein 1
9	9606.ENSP00000316779	0.968	Myc box-dependent-interacting protein 1
10	9606.ENSP00000301046	0.956	Alpha-lactalbumin
11	9606.ENSP00000417138	0.954	Phospholipid transfer protein
12	9606.ENSP00000226218	0.942	Vitronectin
13	9606.ENSP00000222381	0.929	Serum paraoxonase/arylesterase 1
14	9606.ENSP00000362205	0.927	Triggering receptor expressed on myeloid cells 2
15	9606.ENSP00000373364	0.915	Golgi membrane protein 1
16	9606.ENSP00000348170	0.904	Haptoglobin
17	9606.ENSP00000356969	0.899	Apolipoprotein A-II
18	9606.ENSP00000350425	0.883	Apolipoprotein A-IV
19	9606.ENSP00000465356	0.876	Apolipoprotein C-I
20	9606.ENSP00000227667	0.874	Apolipoprotein C-III

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0019899	0.810	enzyme binding
GO:0005102	0.773	signaling receptor binding
GO:0050750	0.605	low-density lipoprotein particle receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.995	regulation of cellular process
GO:0048518	0.991	positive regulation of biological process
GO:0048522	0.953	positive regulation of cellular process
GO:0009987	0.897	cellular process
GO:0060627	0.882	regulation of vesicle-mediated transport
GO:0030100	0.858	regulation of endocytosis
GO:0019222	0.836	regulation of metabolic process
GO:0051130	0.794	positive regulation of cellular component organization
GO:0048519	0.769	negative regulation of biological process
GO:0050896	0.751	response to stimulus
GO:0048523	0.721	negative regulation of cellular process
GO:0060255	0.713	regulation of macromolecule metabolic process
GO:0048259	0.708	regulation of receptor-mediated endocytosis
GO:0010941	0.704	regulation of cell death
GO:0010604	0.700	positive regulation of macromolecule metabolic process
GO:0051050	0.655	positive regulation of transport
GO:0032501	0.503	multicellular organismal process
GO:0008152	0.498	metabolic process
GO:0080090	0.494	regulation of primary metabolic process
GO:0051171	0.483	regulation of nitrogen compound metabolic process
GO:0051246	0.463	regulation of protein metabolic process
GO:0051247	0.430	positive regulation of protein metabolic process
GO:0071704	0.429	organic substance metabolic process
GO:0071840	0.428	cellular component organization or biogenesis
GO:0048583	0.427	regulation of response to stimulus
GO:0031323	0.417	regulation of cellular metabolic process
GO:0044238	0.409	primary metabolic process
GO:0051179	0.396	localization
GO:0002376	0.378	immune system process
GO:0065009	0.357	regulation of molecular function
GO:0006807	0.351	nitrogen compound metabolic process
GO:0009892	0.342	negative regulation of metabolic process
GO:0045807	0.333	positive regulation of endocytosis
GO:0042981	0.331	regulation of apoptotic process
GO:0016043	0.318	cellular component organization
GO:0048584	0.318	positive regulation of response to stimulus
GO:0080134	0.316	regulation of response to stress
GO:0010605	0.302	negative regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0012505	0.997	endomembrane system
GO:0070013	0.997	intracellular organelle lumen
GO:0005829	0.992	cytosol
GO:0005576	0.973	extracellular region
GO:0071944	0.949	cell periphery
GO:0005634	0.921	nucleus
GO:0005615	0.906	extracellular space
GO:0005739	0.859	mitochondrion
GO:0016020	0.853	membrane
GO:0005783	0.800	endoplasmic reticulum
GO:0031982	0.769	vesicle
GO:0005788	0.669	endoplasmic reticulum lumen
GO:0070062	0.644	extracellular exosome
GO:0032991	0.614	protein-containing complex
GO:0120025	0.468	plasma membrane bounded cell projection
GO:0030141	0.337	secretory granule
GO:0043005	0.324	neuron projection

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]