StarFunc result for job id P10912

User Input

>input (638 residues)
MDLWQLLLTLALAGSSDAFSGSEATAAILSRAPWSLQSVNPGLKTNSSKEPKFTKCRSPE
RETFSCHWTDEVHHGTKNLGPIQLFYTRRNTQEWTQEWKECPDYVSAGENSCYFNSSFTS
IWIPYCIKLTSNGGTVDEKCFSVDEIVQPDPPIALNWTLLNVSLTGIHADIQVRWEAPRN
ADIQKGWMVLEYELQYKEVNETKWKMMDPILTTSVPVYSLKVDKEYEVRVRSKQRNSGNY
GEFSEVLYVTLPQMSQFTCEEDFYFPWLLIIIFGIFGLTVMLFVFLFSKQQRIKMLILPP
VPVPKIKGIDPDLLKEGKLEEVNTILAIHDSYKPEFHSDDSWVEFIELDIDEPDEKTEES
DTDRLLSSDHEKSHSNLGVKDGDSGRTSCCEPDILETDFNANDIHEGTSEVAQPQRLKGE
ADLLCLDQKNQNNSPYHDACPATQQPSVIQAEKNKPQPLPTEGAESTHQAAHIQLSNPSS
LSNIDFYAQVSDITPAGSVVLSPGQKNKAGMSQCDMHPEMVSLCQENFLMDNAYFCEADA
KKCIPVAPHIKVESHIQPSLNQEDIYITTESLTTAAGRPGTGEHVPGSEMPVPDYTSIHI
VQSPQGLILNATALPLPDKEFLSSCGYVSTDQLNKIMP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A087X0H5	0.440	0.435	7.417E-92	645	1.000	0.989	A0A087X0H5.pdb.gz	A0A087X0H5_HUMAN Growth hormone receptor OS=Homo sapiens OX=9606 GN=GHR PE=1 SV=1
2	AFDB:P19756	0.532	0.532	1.718E-84	638	0.842	0.842	P19756.pdb.gz	GHR_PIG Growth hormone receptor OS=Sus scrofa OX=9823 GN=GHR PE=1 SV=1
3	AFDB:P19941	0.507	0.507	1.451E-83	638	0.835	0.835	P19941.pdb.gz	GHR_RABIT Growth hormone receptor OS=Oryctolagus cuniculus OX=9986 GN=GHR PE=1 SV=1
4	AFDB:F1MQ39	0.425	0.428	3.165E-75	634	0.766	0.771	F1MQ39.pdb.gz	F1MQ39_BOVIN Growth hormone receptor OS=Bos taurus OX=9913 GN=GHR PE=3 SV=1
5	AFDB:P16310	0.462	0.462	8.388E-73	638	0.697	0.697	P16310.pdb.gz	GHR_RAT Growth hormone receptor OS=Rattus norvegicus OX=10116 GN=Ghr PE=1 SV=1
6	AFDB:Q5MKL1	0.320	0.341	2.018E-40	594	0.332	0.357	Q5MKL1.pdb.gz	Q5MKL1_ONCMY Growth hormone receptor OS=Oncorhynchus mykiss OX=8022 GN=GHR2b PE=2 SV=1
7	AFDB:Q5J7P6	0.329	0.350	3.665E-39	594	0.307	0.330	Q5J7P6.pdb.gz	Q5J7P6_SALSA Growth hormone receptor isoform 1 OS=Salmo salar OX=8030 GN=GHR1 PE=2 SV=1
8	PDB:7u7nC	0.270	0.787	1.064E-13	200	0.067	0.215	7u7nC.pdb.gz
9	AFDB:D9IL84	0.222	0.244	2.192E-13	573	0.143	0.159	D9IL84.pdb.gz	D9IL84_DANRE Cytokine receptor family member b14 OS=Danio rerio OX=7955 GN=crfb14 PE=2 SV=1
10	AFDB:G3V830	0.250	0.275	2.315E-13	569	0.133	0.149	G3V830.pdb.gz	G3V830_RAT Interleukin 10 receptor subunit alpha OS=Rattus norvegicus OX=10116 GN=Il10ra PE=4 SV=1
11	AFDB:P13595	0.136	0.087	3.788E-13	1115	0.150	0.086	P13595.pdb.gz	NCAM1_MOUSE Neural cell adhesion molecule 1 OS=Mus musculus OX=10090 GN=Ncam1 PE=1 SV=3
12	PDB:7z0lB	0.240	0.392	2.514E-10	370	0.064	0.111	7z0lB.pdb.gz
13	PDB:5mj3A	0.222	0.431	7.471E-9	302	0.056	0.119	5mj3A.pdb.gz
14	PDB:3besR	0.197	0.403	7.433E-8	250	0.064	0.164	3besR.pdb.gz
15	PDB:6pxvA	0.145	0.117	1.278E-6	823	0.050	0.039	6pxvA.pdb.gz
16	PDB:8dtlA	0.140	0.123	1.278E-6	741	0.050	0.043	8dtlA.pdb.gz
17	PDB:8eyyA	0.146	0.125	8.671E-6	775	0.053	0.044	8eyyA.pdb.gz
18	PDB:6xi2A	0.133	0.159	2.321E-5	528	0.034	0.042	6xi2A.pdb.gz	Crystal structures of beta-1,4-N-acetylglucosaminyltransferase 2: structural basis for inherited muscular dystrophies.
19	PDB:5oj2B	0.167	0.158	2.889E-5	692	0.047	0.043	5oj2B.pdb.gz
20	PDB:7bwaA	0.139	0.133	1.198E-4	674	0.058	0.055	7bwaA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A087X0H5	0.0	1326	645	1.000	0.989	A0A087X0H5_HUMAN Growth hormone receptor OS=Homo sapiens OX=9606 GN=GHR PE=1 SV=1
2	A0A087X162	0.0	618	295	0.458	0.990	A0A087X162_HUMAN Growth hormone receptor OS=Homo sapiens OX=9606 GN=GHR PE=1 SV=1
3	F1MQ39	0.0	1015	634	0.766	0.771	F1MQ39_BOVIN Growth hormone receptor OS=Bos taurus OX=9913 GN=GHR PE=3 SV=1
4	O46600	0.0	1031	634	0.766	0.771	GHR_BOVIN Growth hormone receptor OS=Bos taurus OX=9913 GN=GHR PE=2 SV=2
5	P10912	0.0	1328	638	1.000	1.000	GHR_HUMAN Growth hormone receptor OS=Homo sapiens OX=9606 GN=GHR PE=1 SV=1
6	P16310	0.0	913	638	0.699	0.699	GHR_RAT Growth hormone receptor OS=Rattus norvegicus OX=10116 GN=Ghr PE=1 SV=1
7	P16882	0.0	886	650	0.693	0.680	GHR_MOUSE Growth hormone receptor OS=Mus musculus OX=10090 GN=Ghr PE=1 SV=1
8	P19756	0.0	1123	638	0.842	0.842	GHR_PIG Growth hormone receptor OS=Sus scrofa OX=9823 GN=GHR PE=1 SV=1
9	P19941	0.0	1112	638	0.837	0.837	GHR_RABIT Growth hormone receptor OS=Oryctolagus cuniculus OX=9986 GN=GHR PE=1 SV=1
10	Q2P9V4	0.0	1015	634	0.766	0.771	Q2P9V4_BOVIN Growth hormone receptor OS=Bos taurus OX=9913 GN=GHR PE=3 SV=1
11	Q0R5T2	1.77e-169	487	300	0.368	0.783	Q0R5T2_BOVIN Growth hormone receptor (Fragment) OS=Bos taurus OX=9913 GN=GHR PE=4 SV=1
12	Q0R5V0	1.95e-169	486	300	0.368	0.783	Q0R5V0_BOVIN Growth hormone receptor (Fragment) OS=Bos taurus OX=9913 GN=GHR PE=4 SV=1
13	Q0R5T9	6.91e-169	485	300	0.367	0.780	Q0R5T9_BOVIN Growth hormone receptor (Fragment) OS=Bos taurus OX=9913 GN=GHR PE=4 SV=1
14	Q0R5T3	1.02e-168	485	300	0.367	0.780	Q0R5T3_BOVIN Growth hormone receptor (Fragment) OS=Bos taurus OX=9913 GN=GHR PE=4 SV=1
15	Q0R5T7	1.24e-168	484	300	0.367	0.780	Q0R5T7_BOVIN Growth hormone receptor (Fragment) OS=Bos taurus OX=9913 GN=GHR PE=4 SV=1
16	Q0R5T5	1.30e-168	484	300	0.367	0.780	Q0R5T5_BOVIN Growth hormone receptor (Fragment) OS=Bos taurus OX=9913 GN=GHR PE=4 SV=1
17	Q0R5T6	1.30e-168	484	300	0.367	0.780	Q0R5T6_BOVIN Growth hormone receptor (Fragment) OS=Bos taurus OX=9913 GN=GHR PE=4 SV=1
18	Q0R5T4	7.42e-168	483	300	0.365	0.777	Q0R5T4_BOVIN Growth hormone receptor (Fragment) OS=Bos taurus OX=9913 GN=GHR PE=4 SV=1
19	Q0R5U2	8.18e-168	483	300	0.365	0.777	Q0R5U2_BOVIN Growth hormone receptor (Fragment) OS=Bos taurus OX=9913 GN=GHR PE=4 SV=1
20	Q50H41	5.82e-102	324	591	0.335	0.362	Q50H41_ONCMY Growth hormone receptor type II OS=Oncorhynchus mykiss OX=8022 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09067 EpoR_lig-bind	5.5e-07	41.1	Erythropoietin receptor, ligand binding
2	PF00041 fn3	0.009	27.7	Fibronectin type III domain
3	PF12772 GHBP	1.1e-128	440.5	Growth hormone receptor binding

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000483403

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000312673	0.999	Somatotropin
2	9606.ENSP00000371067	0.999	Tyrosine-protein kinase JAK2
3	9606.ENSP00000341208	0.996	Signal transducer and activator of transcription 5A
4	9606.ENSP00000293328	0.988	Signal transducer and activator of transcription 5B
5	9606.ENSP00000481249	0.975	Suppressor of cytokine signaling 2
6	9606.ENSP00000333157	0.973	Growth hormone 1 isoform 5
7	9606.ENSP00000409346	0.970	Cytokine-inducible SH2-containing protein
8	9606.ENSP00000304895	0.949	Insulin receptor substrate 1
9	9606.ENSP00000428056	0.948	Phosphatidylinositol 3-kinase regulatory subunit alpha
10	9606.ENSP00000244007	0.935	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1
11	9606.ENSP00000365016	0.928	Insulin receptor substrate 2
12	9606.ENSP00000263025	0.922	Mitogen-activated protein kinase 3
13	9606.ENSP00000391592	0.920	Tyrosine-protein phosphatase non-receptor type 6
14	9606.ENSP00000316416	0.916	Chorionic somatomammotropin hormone 1
15	9606.ENSP00000321221	0.915	SH2B adapter protein 1
16	9606.ENSP00000376623	0.914	Chorionic somatomammotropin hormone 2
17	9606.ENSP00000309968	0.911	Disintegrin and metalloproteinase domain-containing protein 17
18	9606.ENSP00000215832	0.907	Mitogen-activated protein kinase 1
19	9606.ENSP00000430690	0.906	Trefoil factor 3
20	9606.ENSP00000263967	0.904	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0017046	0.999	peptide hormone binding
GO:0004896	0.679	cytokine receptor activity
GO:0070064	0.486	proline-rich region binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0050794	0.997	regulation of cellular process
GO:0050896	0.996	response to stimulus
GO:0051716	0.993	cellular response to stimulus
GO:0048518	0.991	positive regulation of biological process
GO:0023052	0.990	signaling
GO:0007154	0.990	cell communication
GO:0060416	0.981	response to growth hormone
GO:0007165	0.978	signal transduction
GO:0007166	0.970	cell surface receptor signaling pathway
GO:0071375	0.965	cellular response to peptide hormone stimulus
GO:0019222	0.952	regulation of metabolic process
GO:0007169	0.950	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0060255	0.942	regulation of macromolecule metabolic process
GO:0048522	0.940	positive regulation of cellular process
GO:0080090	0.934	regulation of primary metabolic process
GO:0031323	0.934	regulation of cellular metabolic process
GO:0051171	0.926	regulation of nitrogen compound metabolic process
GO:0001934	0.907	positive regulation of protein phosphorylation
GO:0050730	0.748	regulation of peptidyl-tyrosine phosphorylation
GO:0008152	0.595	metabolic process
GO:0050731	0.538	positive regulation of peptidyl-tyrosine phosphorylation
GO:0071704	0.476	organic substance metabolic process
GO:0048583	0.439	regulation of response to stimulus
GO:0050793	0.437	regulation of developmental process
GO:0051239	0.420	regulation of multicellular organismal process
GO:0023051	0.410	regulation of signaling
GO:0010646	0.409	regulation of cell communication
GO:0044237	0.378	cellular metabolic process
GO:0044238	0.346	primary metabolic process
GO:0009966	0.335	regulation of signal transduction
GO:0048584	0.306	positive regulation of response to stimulus
GO:0032502	0.300	developmental process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.998	membrane
GO:0005829	0.995	cytosol
GO:0005886	0.969	plasma membrane
GO:0005576	0.957	extracellular region
GO:0043226	0.944	organelle
GO:0043229	0.926	intracellular organelle
GO:0005615	0.789	extracellular space
GO:0043231	0.563	intracellular membrane-bounded organelle
GO:0031981	0.336	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]