StarFunc result for job id P10914

User Input

>input (325 residues)
MPITRMRMRPWLEMQINSNQIPGLIWINKEEMIFQIPWKHAAKHGWDINKDACLFRSWAI
HTGRYKAGEKEPDPKTWKANFRCAMNSLPDIEEVKDQSRNKGSSAVRVYRMLPPLTKNQR
KERKSKSSRDAKSKAKRKSCGDSSPDTFSDGLSSSTLPDDHSSYTVPGYMQDLEVEQALT
PALSPCAVSSTLPDWHIPVEVVPDSTSDLYNFQVSPMPSTSEATTDEDEEGKLPEDIMKL
LEQSEWQPTNVDGKGYLLNEPGVQPTSVYGDFSCKEEPEIDSPGGDIGLSLQRVFTDLKN
MDATWLDSLLTPVRLPSIQAIPCAP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P10914	1.000	1.000	8.294E-58	325	1.000	1.000	P10914.pdb.gz	IRF1_HUMAN Interferon regulatory factor 1 OS=Homo sapiens OX=9606 GN=IRF1 PE=1 SV=2
2	AFDB:P15314	0.707	0.700	2.518E-50	329	0.855	0.845	P15314.pdb.gz	IRF1_MOUSE Interferon regulatory factor 1 OS=Mus musculus OX=10090 GN=Irf1 PE=1 SV=1
3	AFDB:A8QKA6	0.389	0.404	8.396E-24	312	0.385	0.401	A8QKA6.pdb.gz	A8QKA6_SALSA Interferon regulatory factor OS=Salmo salar OX=8030 GN=IRF-1 PE=2 SV=1
4	AFDB:B5DDP2	0.363	0.409	1.535E-23	287	0.418	0.474	B5DDP2.pdb.gz
5	AFDB:P14316	0.360	0.336	4.383E-22	349	0.425	0.395	P14316.pdb.gz	IRF2_HUMAN Interferon regulatory factor 2 OS=Homo sapiens OX=9606 GN=IRF2 PE=1 SV=2
6	AFDB:B5X185	0.351	0.333	8.014E-22	343	0.354	0.335	B5X185.pdb.gz	B5X185_SALSA Interferon regulatory factor OS=Salmo salar OX=8030 GN=IRF2 PE=2 SV=1
7	AFDB:Q15306	0.322	0.232	1.362E-15	451	0.218	0.157	Q15306.pdb.gz	IRF4_HUMAN Interferon regulatory factor 4 OS=Homo sapiens OX=9606 GN=IRF4 PE=1 SV=1
8	AFDB:A8B8L1	0.329	0.233	2.178E-15	460	0.212	0.150	A8B8L1.pdb.gz
9	AFDB:H0YNP4	0.347	0.418	2.663E-15	267	0.206	0.251	H0YNP4.pdb.gz	H0YNP4_HUMAN Interferon regulatory factor 9 OS=Homo sapiens OX=9606 GN=IRF9 PE=1 SV=2
10	AFDB:Q13568	0.317	0.211	6.651E-14	498	0.234	0.153	Q13568.pdb.gz	IRF5_HUMAN Interferon regulatory factor 5 OS=Homo sapiens OX=9606 GN=IRF5 PE=1 SV=2
11	PDB:7p2e8	0.129	0.193	1.067E-1	191	0.031	0.052	7p2e8.pdb.gz	Structure of the mitoribosomal small subunit with streptomycin reveals Fe-S clusters and physiological molecules.
12	PDB:7a6hP	0.128	0.238	1.824E-1	146	0.018	0.041	7a6hP.pdb.gz	Cryo-EM structures of human RNA polymerase III in its unbound and transcribing states.
13	PDB:6jclG	0.095	0.133	9.113E-1	219	0.028	0.041	6jclG.pdb.gz	Structural and biochemical characterization of Rv0187, an O-methyltransferase from Mycobacterium tuberculosis.
14	PDB:1w7pB	0.142	0.213	1.042	182	0.049	0.088	1w7pB.pdb.gz
15	PDB:1xsdA	0.126	0.242	1.042	125	0.043	0.112	1xsdA.pdb.gz	Crystal structures of the BlaI repressor from Staphylococcus aureus and its complex with DNA: insights into transcriptional regulation of the bla and mec operons
16	PDB:7asvA	0.111	0.186	1.042	155	0.022	0.045	7asvA.pdb.gz
17	PDB:4yrvA	0.146	0.160	1.274	288	0.040	0.045	4yrvA.pdb.gz	Structural insights into HetR-PatS interaction involved in cyanobacterial pattern formation
18	PDB:4ewsA	0.081	0.061	1.362	472	0.025	0.017	4ewsA.pdb.gz	Crystal structures of cholesteryl ester transfer protein in complex with inhibitors.
19	PDB:5hs7A	0.104	0.220	1.362	102	0.025	0.078	5hs7A.pdb.gz
20	PDB:4v6wCU	0.100	0.221	1.457	116	0.037	0.103	4v6wCU.pdb.gz	Structures of the human and Drosophila 80S ribosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P10914	0.0	672	325	1.000	1.000	IRF1_HUMAN Interferon regulatory factor 1 OS=Homo sapiens OX=9606 GN=IRF1 PE=1 SV=2
2	P15314	0.0	578	329	0.855	0.845	IRF1_MOUSE Interferon regulatory factor 1 OS=Mus musculus OX=10090 GN=Irf1 PE=1 SV=1
3	P23570	0.0	575	328	0.852	0.845	IRF1_RAT Interferon regulatory factor 1 OS=Rattus norvegicus OX=10116 GN=Irf1 PE=2 SV=1
4	Q6TGZ2	2.30e-70	222	287	0.397	0.449	Q6TGZ2_DANRE Interferon regulatory factor OS=Danio rerio OX=7955 GN=IRF1 PE=2 SV=1
5	B5XBW9	1.43e-66	213	312	0.351	0.365	B5XBW9_SALSA Interferon regulatory factor OS=Salmo salar OX=8030 GN=IRF1 PE=2 SV=1
6	A8QKA6	1.48e-66	213	312	0.351	0.365	A8QKA6_SALSA Interferon regulatory factor OS=Salmo salar OX=8030 GN=IRF-1 PE=2 SV=1
7	P14316	3.96e-65	211	349	0.391	0.364	IRF2_HUMAN Interferon regulatory factor 2 OS=Homo sapiens OX=9606 GN=IRF2 PE=1 SV=2
8	K4DIA5	9.07e-61	194	176	0.265	0.489	K4DIA5_HUMAN Interferon regulatory factor 2 (Fragment) OS=Homo sapiens OX=9606 GN=IRF2 PE=1 SV=1
9	B5X185	3.11e-58	192	343	0.271	0.257	B5X185_SALSA Interferon regulatory factor OS=Salmo salar OX=8030 GN=IRF2 PE=2 SV=1
10	A8QKA7	1.19e-57	191	343	0.271	0.257	A8QKA7_SALSA Interferon regulatory factor OS=Salmo salar OX=8030 GN=IRF-2 PE=2 SV=1
11	B5X8L4	7.86e-41	145	283	0.280	0.322	B5X8L4_SALSA Interferon regulatory factor OS=Salmo salar OX=8030 GN=IRF1 PE=2 SV=1
12	H3BT31	4.33e-29	115	328	0.172	0.171	H3BT31_HUMAN Interferon regulatory factor 8 (Fragment) OS=Homo sapiens OX=9606 GN=IRF8 PE=1 SV=1
13	Q02556	1.34e-28	116	426	0.172	0.131	IRF8_HUMAN Interferon regulatory factor 8 OS=Homo sapiens OX=9606 GN=IRF8 PE=1 SV=2
14	P23611	4.63e-28	114	424	0.172	0.132	IRF8_MOUSE Interferon regulatory factor 8 OS=Mus musculus OX=10090 GN=Irf8 PE=1 SV=1
15	A0A8I6AJP7	2.09e-27	113	466	0.169	0.118	A0A8I6AJP7_RAT Interferon regulatory factor 8 OS=Rattus norvegicus OX=10116 GN=Irf8 PE=4 SV=1
16	Q15306	3.13e-27	112	451	0.154	0.111	IRF4_HUMAN Interferon regulatory factor 4 OS=Homo sapiens OX=9606 GN=IRF4 PE=1 SV=1
17	Q64287	3.56e-27	112	450	0.151	0.109	IRF4_MOUSE Interferon regulatory factor 4 OS=Mus musculus OX=10090 GN=Irf4 PE=1 SV=1
18	P56477	2.81e-26	110	497	0.145	0.095	IRF5_MOUSE Interferon regulatory factor 5 OS=Mus musculus OX=10090 GN=Irf5 PE=1 SV=1
19	Q13568	4.05e-26	110	498	0.145	0.094	IRF5_HUMAN Interferon regulatory factor 5 OS=Homo sapiens OX=9606 GN=IRF5 PE=1 SV=2
20	D3ZPU1	4.27e-26	110	497	0.145	0.095	D3ZPU1_RAT Interferon regulatory factor 5 OS=Rattus norvegicus OX=10116 GN=Irf5 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00605 IRF	1.1e-38	143.0	Interferon regulatory factor transcription factor

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000245414

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000354394	0.999	Signal transducer and activator of transcription 1-alpha/beta
2	9606.ENSP00000263253	0.997	Histone acetyltransferase p300
3	9606.ENSP00000360266	0.990	Transcription factor AP-1
4	9606.ENSP00000219548	0.981	E3 ubiquitin-protein ligase CHIP
5	9606.ENSP00000315768	0.980	Signal transducer and activator of transcription 2
6	9606.ENSP00000384273	0.978	Transcription factor p65
7	9606.ENSP00000381601	0.977	Interferon-induced GTP-binding protein Mx1
8	9606.ENSP00000369581	0.975	Interferon beta
9	9606.ENSP00000380073	0.974	Interferon regulatory factor 9
10	9606.ENSP00000263754	0.973	Histone acetyltransferase KAT2B
11	9606.ENSP00000359497	0.973	Guanylate-binding protein 2
12	9606.ENSP00000368699	0.972	Ubiquitin-like protein ISG15
13	9606.ENSP00000371471	0.972	Radical S-adenosyl methionine domain-containing protein 2
14	9606.ENSP00000360869	0.971	Interferon-induced protein with tetratricopeptide repeats 1
15	9606.ENSP00000229135	0.969	Interferon gamma
16	9606.ENSP00000360883	0.967	Interferon-induced protein with tetratricopeptide repeats 3
17	9606.ENSP00000360891	0.967	Interferon-induced protein with tetratricopeptide repeats 2
18	9606.ENSP00000257570	0.966	2'-5'-oligoadenylate synthase-like protein
19	9606.ENSP00000306565	0.962	Interferon-stimulated gene 20 kDa protein
20	9606.ENSP00000333657	0.962	Interferon-induced GTP-binding protein Mx2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0001216	1.000	DNA-binding transcription activator activity
GO:0000981	1.000	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000976	0.997	transcription cis-regulatory region binding
GO:0001228	0.986	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0000977	0.984	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000987	0.836	cis-regulatory region sequence-specific DNA binding
GO:0000978	0.830	RNA polymerase II cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.996	response to stimulus
GO:0050794	0.996	regulation of cellular process
GO:0009987	0.990	cellular process
GO:0048522	0.990	positive regulation of cellular process
GO:0010468	0.990	regulation of gene expression
GO:0080090	0.988	regulation of primary metabolic process
GO:0051171	0.988	regulation of nitrogen compound metabolic process
GO:0031323	0.985	regulation of cellular metabolic process
GO:0010604	0.985	positive regulation of macromolecule metabolic process
GO:0048519	0.984	negative regulation of biological process
GO:0051716	0.982	cellular response to stimulus
GO:0048583	0.971	regulation of response to stimulus
GO:0001817	0.966	regulation of cytokine production
GO:0006357	0.964	regulation of transcription by RNA polymerase II
GO:0048523	0.961	negative regulation of cellular process
GO:0006950	0.958	response to stress
GO:0042221	0.955	response to chemical
GO:0009615	0.953	response to virus
GO:0045893	0.952	positive regulation of DNA-templated transcription
GO:0071345	0.947	cellular response to cytokine stimulus
GO:0001819	0.921	positive regulation of cytokine production
GO:0010605	0.917	negative regulation of macromolecule metabolic process
GO:0031347	0.895	regulation of defense response
GO:0006952	0.889	defense response
GO:0002682	0.878	regulation of immune system process
GO:0045944	0.878	positive regulation of transcription by RNA polymerase II
GO:0032101	0.876	regulation of response to external stimulus
GO:0098542	0.875	defense response to other organism
GO:0002831	0.839	regulation of response to biotic stimulus
GO:0031324	0.838	negative regulation of cellular metabolic process
GO:0051607	0.808	defense response to virus
GO:0051172	0.762	negative regulation of nitrogen compound metabolic process
GO:0007154	0.725	cell communication
GO:0032479	0.725	regulation of type I interferon production
GO:0050776	0.658	regulation of immune response
GO:0023052	0.596	signaling
GO:0007165	0.574	signal transduction
GO:0002376	0.530	immune system process
GO:0071704	0.526	organic substance metabolic process
GO:0044238	0.519	primary metabolic process
GO:0006807	0.492	nitrogen compound metabolic process
GO:0045088	0.466	regulation of innate immune response
GO:0023051	0.456	regulation of signaling
GO:0042127	0.448	regulation of cell population proliferation
GO:0006955	0.447	immune response
GO:0010646	0.442	regulation of cell communication
GO:0009966	0.432	regulation of signal transduction
GO:0048584	0.425	positive regulation of response to stimulus
GO:0045934	0.383	negative regulation of nucleobase-containing compound metabolic process
GO:0051253	0.371	negative regulation of RNA metabolic process
GO:0010558	0.366	negative regulation of macromolecule biosynthetic process
GO:0043170	0.365	macromolecule metabolic process
GO:0031327	0.354	negative regulation of cellular biosynthetic process
GO:0044237	0.335	cellular metabolic process
GO:0045892	0.332	negative regulation of DNA-templated transcription
GO:0002684	0.328	positive regulation of immune system process
GO:0007166	0.322	cell surface receptor signaling pathway
GO:0032481	0.305	positive regulation of type I interferon production

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005654	0.995	nucleoplasm
GO:0043232	0.979	intracellular non-membrane-bounded organelle
GO:0005829	0.968	cytosol
GO:0000785	0.505	chromatin

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]