StarFunc result for job id P10916

User Input

>input (166 residues)
MAPKKAKKRAGGANSNVFSMFEQTQIQEFKEAFTIMDQNRDGFIDKNDLRDTFAALGRVN
VKNEEIDEMIKEAPGPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGVLKADYVR
EMLTTQAERFSKEEVDQMFAAFPPDVTGNLDYKNLVHIITHGEEKD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P08733	0.935	0.935	6.435E-27	166	0.958	0.958	P08733.pdb.gz	MLRV_RAT Myosin regulatory light chain 2, ventricular/cardiac muscle isoform OS=Rattus norvegicus OX=10116 GN=Myl2 PE=1 SV=2
2	AFDB:Q62082	0.604	0.506	1.305E-23	202	0.801	0.658	Q62082.pdb.gz	MYL10_MOUSE Myosin regulatory light chain 10 OS=Mus musculus OX=10090 GN=Myl10 PE=2 SV=1
3	AFDB:A0A060WU79	0.716	0.613	4.767E-22	200	0.729	0.605	A0A060WU79.pdb.gz	A0A060WU79_ONCMY EF-hand domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00039796001 PE=4 SV=1
4	AFDB:P04466	0.816	0.802	2.406E-21	169	0.735	0.722	P04466.pdb.gz	MYL11_RAT Myosin regulatory light chain 11 OS=Rattus norvegicus OX=10116 GN=Myl11 PE=1 SV=2
5	AFDB:A7XZM2	0.758	0.743	7.518E-21	170	0.681	0.665	A7XZM2.pdb.gz	A7XZM2_ONCMY Fast myosin light chain 2 OS=Oncorhynchus mykiss OX=8022 PE=2 SV=1
6	AFDB:Q02045	0.781	0.753	7.340E-20	173	0.663	0.636	Q02045.pdb.gz	MYL5_HUMAN Myosin light chain 5 OS=Homo sapiens OX=9606 GN=MYL5 PE=2 SV=1
7	AFDB:Q7T2Y1	0.834	0.808	1.507E-19	172	0.608	0.587	Q7T2Y1.pdb.gz
8	AFDB:Q01449	0.727	0.696	2.586E-19	175	0.608	0.577	Q01449.pdb.gz	MLRA_HUMAN Myosin regulatory light chain 2, atrial isoform OS=Homo sapiens OX=9606 GN=MYL7 PE=1 SV=1
9	AFDB:Q9BUA6	0.771	0.575	2.586E-19	226	0.807	0.593	Q9BUA6.pdb.gz	MYL10_HUMAN Myosin regulatory light chain 10 OS=Homo sapiens OX=9606 GN=MYL10 PE=1 SV=2
10	AFDB:A0A0G2JSW0	0.821	0.796	4.078E-18	172	0.554	0.535	A0A0G2JSW0.pdb.gz	A0A0G2JSW0_RAT Myosin light chain 12A OS=Rattus norvegicus OX=10116 GN=Myl12b PE=4 SV=2
11	PDB:5tbyE	0.594	0.610	1.348E-17	160	0.964	1.000	5tbyE.pdb.gz
12	PDB:7qioP	0.473	0.539	1.414E-14	143	0.633	0.734	7qioP.pdb.gz
13	PDB:1i84U	0.689	0.807	1.466E-13	138	0.554	0.667	1i84U.pdb.gz
14	PDB:7mf3D	0.726	0.757	2.178E-12	158	0.512	0.538	7mf3D.pdb.gz	Cryo-EM structure of the autoinhibited state of myosin-2.
15	PDB:3wfnB	0.393	0.390	6.723E-9	169	0.325	0.320	3wfnB.pdb.gz
16	PDB:1ggzA	0.502	0.570	1.863E-8	144	0.307	0.354	1ggzA.pdb.gz	Crystal structure of human calmodulin-like protein: insights into its functional role.
17	PDB:5a2hA	0.472	0.520	5.821E-8	147	0.295	0.333	5a2hA.pdb.gz	Crystal Structure of Arabidopsis Thaliana Calmodulin7 and Insight Into its Mode of DNA Binding.
18	PDB:1m46A	0.403	0.450	1.519E-7	148	0.229	0.257	1m46A.pdb.gz	Two distinct myosin light chain structures are induced by specific variations within the bound IQ motifs-functional implications
19	PDB:1osaA	0.412	0.450	2.768E-7	148	0.301	0.338	1osaA.pdb.gz	Structure of the recombinant Paramecium tetraurelia calmodulin at 1.68 A resolution.
20	PDB:2f2pA	0.377	0.371	2.768E-7	169	0.325	0.320	2f2pA.pdb.gz	Structure of calmodulin bound to a calcineurin Peptide: a new way of making an old binding mode.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P10916	2.99e-120	337	166	1.000	1.000	MLRV_HUMAN Myosin regulatory light chain 2, ventricular/cardiac muscle isoform OS=Homo sapiens OX=9606 GN=MYL2 PE=1 SV=3
2	P51667	8.01e-116	326	166	0.964	0.964	MLRV_MOUSE Myosin regulatory light chain 2, ventricular/cardiac muscle isoform OS=Mus musculus OX=10090 GN=Myl2 PE=1 SV=3
3	P08733	1.42e-115	326	166	0.958	0.958	MLRV_RAT Myosin regulatory light chain 2, ventricular/cardiac muscle isoform OS=Rattus norvegicus OX=10116 GN=Myl2 PE=1 SV=2
4	Q62082	3.42e-97	281	202	0.801	0.658	MYL10_MOUSE Myosin regulatory light chain 10 OS=Mus musculus OX=10090 GN=Myl10 PE=2 SV=1
5	Q9BUA6	4.36e-91	266	226	0.807	0.593	MYL10_HUMAN Myosin regulatory light chain 10 OS=Homo sapiens OX=9606 GN=MYL10 PE=1 SV=2
6	P97457	5.42e-91	264	169	0.741	0.728	MYL11_MOUSE Myosin regulatory light chain 11 OS=Mus musculus OX=10090 GN=Myl11 PE=1 SV=3
7	P02609	8.31e-91	263	168	0.723	0.714	MYL11_CHICK Myosin regulatory light chain 11 OS=Gallus gallus OX=9031 GN=MYL11 PE=1 SV=2
8	P04466	3.27e-90	262	169	0.735	0.722	MYL11_RAT Myosin regulatory light chain 11 OS=Rattus norvegicus OX=10116 GN=Myl11 PE=1 SV=2
9	Q96A32	9.27e-89	258	169	0.723	0.710	MYL11_HUMAN Myosin regulatory light chain 11 OS=Homo sapiens OX=9606 GN=MYL11 PE=1 SV=1
10	O93409	3.89e-87	254	169	0.699	0.686	MLRSA_DANRE Myosin regulatory light chain 2, skeletal muscle isoform A OS=Danio rerio OX=7955 GN=mylpfa PE=1 SV=1
11	A7XZM2	8.37e-84	246	170	0.681	0.665	A7XZM2_ONCMY Fast myosin light chain 2 OS=Oncorhynchus mykiss OX=8022 PE=2 SV=1
12	A7XZM0	3.11e-83	244	168	0.675	0.667	A7XZM0_ONCMY Slow myosin light chain 2 OS=Oncorhynchus mykiss OX=8022 PE=2 SV=1
13	A0A060WU79	5.87e-83	244	200	0.669	0.555	A0A060WU79_ONCMY EF-hand domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00039796001 PE=4 SV=1
14	Q9I9H9	5.14e-81	238	170	0.657	0.641	Q9I9H9_ONCKI Myosin light chain 2 OS=Oncorhynchus kisutch OX=8019 PE=2 SV=1
15	A0A060WH27	1.87e-79	234	149	0.645	0.718	A0A060WH27_ONCMY EF-hand domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00071433001 PE=4 SV=1
16	Q02045	8.59e-79	233	173	0.663	0.636	MYL5_HUMAN Myosin light chain 5 OS=Homo sapiens OX=9606 GN=MYL5 PE=2 SV=1
17	A0A060XEV5	3.11e-75	223	149	0.596	0.664	A0A060XEV5_ONCMY EF-hand domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00044007001 PE=4 SV=1
18	Q801M3	5.39e-73	218	172	0.627	0.605	Q801M3_DANRE Myosin light chain 2 Mlc2a OS=Danio rerio OX=7955 GN=cmlc2 PE=1 SV=1
19	Q01449	8.44e-73	218	175	0.608	0.577	MLRA_HUMAN Myosin regulatory light chain 2, atrial isoform OS=Homo sapiens OX=9606 GN=MYL7 PE=1 SV=1
20	Q9QVP4	1.12e-71	215	175	0.590	0.560	MLRA_MOUSE Myosin regulatory light chain 2, atrial isoform OS=Mus musculus OX=10090 GN=Myl7 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05042 Caleosin	2e+02	13.3	Caleosin related protein
2	PF00036 EF-hand_1	5.9e-12	55.3	EF hand
3	PF13202 EF-hand_5	0.99	20.2	EF hand
4	PF13405 EF-hand_6	5.3e-07	40.0	EF-hand domain
5	PF13499 EF-hand_7	3.4e-07	41.9	EF-hand domain pair
6	PF13833 EF-hand_8	0.00037	31.5	EF-hand domain pair

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000228841

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000347507	0.997	Myosin-7
2	9606.ENSP00000379210	0.993	Myosin light chain 3
3	9606.ENSP00000386041	0.985	Myosin-6
4	9606.ENSP00000353452	0.979	Myosin light chain kinase, smooth muscle
5	9606.ENSP00000317985	0.978	Rho-associated protein kinase 2
6	9606.ENSP00000327758	0.978	Homeobox protein Nkx-2.5
7	9606.ENSP00000389168	0.969	Protein phosphatase 1 regulatory subunit 12A
8	9606.ENSP00000334458	0.963	Transcription factor GATA-4
9	9606.ENSP00000382697	0.963	Rho-associated protein kinase 1
10	9606.ENSP00000470298	0.963	Myosin-14
11	9606.ENSP00000290378	0.962	Actin, alpha cardiac muscle 1
12	9606.ENSP00000353590	0.962	Myosin-10
13	9606.ENSP00000355731	0.960	Serine/threonine-protein kinase MRCK alpha
14	9606.ENSP00000376306	0.959	Citron Rho-interacting kinase
15	9606.ENSP00000340874	0.957	Myocyte-specific enhancer factor 2C
16	9606.ENSP00000307280	0.956	Myosin light chain 1/3, skeletal muscle isoform
17	9606.ENSP00000216181	0.952	Myosin-9
18	9606.ENSP00000379616	0.949	Myosin-11
19	9606.ENSP00000236918	0.947	Troponin T, cardiac muscle
20	9606.ENSP00000341838	0.947	Troponin I, cardiac muscle

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008307	0.999	structural constituent of muscle
GO:0043167	0.725	ion binding
GO:0008092	0.545	cytoskeletal protein binding
GO:0046872	0.475	metal ion binding
GO:0005509	0.392	calcium ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.991	multicellular organismal process
GO:0050789	0.986	regulation of biological process
GO:0061061	0.984	muscle structure development
GO:0009987	0.980	cellular process
GO:0060537	0.978	muscle tissue development
GO:0014706	0.966	striated muscle tissue development
GO:0007507	0.963	heart development
GO:0044057	0.962	regulation of system process
GO:0048738	0.950	cardiac muscle tissue development
GO:0003012	0.908	muscle system process
GO:0006936	0.895	muscle contraction
GO:0003007	0.858	heart morphogenesis
GO:0060415	0.819	muscle tissue morphogenesis
GO:0050794	0.809	regulation of cellular process
GO:0008016	0.776	regulation of heart contraction
GO:0060047	0.765	heart contraction
GO:0030154	0.673	cell differentiation
GO:0048468	0.577	cell development
GO:0071840	0.514	cellular component organization or biogenesis
GO:0055007	0.497	cardiac muscle cell differentiation
GO:0055013	0.490	cardiac muscle cell development
GO:0048518	0.465	positive regulation of biological process
GO:0016043	0.465	cellular component organization
GO:0006941	0.407	striated muscle contraction
GO:0090257	0.385	regulation of muscle system process
GO:0048519	0.354	negative regulation of biological process
GO:0003205	0.353	cardiac chamber development
GO:0060048	0.342	cardiac muscle contraction
GO:0050896	0.340	response to stimulus
GO:0030029	0.327	actin filament-based process
GO:0003229	0.311	ventricular cardiac muscle tissue development
GO:0065008	0.301	regulation of biological quality

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043292	0.998	contractile fiber
GO:0005829	0.932	cytosol
GO:0030016	0.931	myofibril
GO:0043227	0.791	membrane-bounded organelle
GO:0032991	0.771	protein-containing complex
GO:0043231	0.711	intracellular membrane-bounded organelle
GO:0030017	0.527	sarcomere
GO:0005856	0.523	cytoskeleton
GO:0015629	0.472	actin cytoskeleton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]