StarFunc result for job id P10966

User Input

>input (210 residues)
MRPRLWLLLAAQLTVLHGNSVLQQTPAYIKVQTNKMVMLSCEAKISLSNMRIYWLRQRQA
PSSDSHHEFLALWDSAKGTIHGEEVEQEKIAVFRDASRFILNLTSVKPEDSGIYFCMIVG
SPELTFGKGTQLSVVDFLPTTAQPTKKSTLKKRVCRLPRPETQKGPLCSPITLGLLVAGV
LVLLVSLGVAIHLCCRRRRARLRFMKQFYK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P10966	1.000	1.000	7.149E-37	210	1.000	1.000	P10966.pdb.gz	CD8B_HUMAN T-cell surface glycoprotein CD8 beta chain OS=Homo sapiens OX=9606 GN=CD8B PE=1 SV=1
2	AFDB:P10300	0.590	0.583	3.930E-23	213	0.529	0.521	P10300.pdb.gz	CD8B_MOUSE T-cell surface glycoprotein CD8 beta chain OS=Mus musculus OX=10090 GN=Cd8b PE=1 SV=1
3	AFDB:P09564	0.480	0.425	1.797E-12	240	0.210	0.183	P09564.pdb.gz	CD7_HUMAN T-cell antigen CD7 OS=Homo sapiens OX=9606 GN=CD7 PE=1 SV=1
4	AFDB:P07725	0.508	0.454	1.899E-12	236	0.229	0.203	P07725.pdb.gz	CD8A_RAT T-cell surface glycoprotein CD8 alpha chain OS=Rattus norvegicus OX=10116 GN=Cd8a PE=1 SV=1
5	AFDB:P01732	0.520	0.469	1.396E-11	235	0.224	0.200	P01732.pdb.gz	CD8A_HUMAN T-cell surface glycoprotein CD8 alpha chain OS=Homo sapiens OX=9606 GN=CD8A PE=1 SV=1
6	AFDB:P01731	0.496	0.424	4.469E-11	247	0.229	0.194	P01731.pdb.gz	CD8A_MOUSE T-cell surface glycoprotein CD8 alpha chain OS=Mus musculus OX=10090 GN=Cd8a PE=1 SV=1
7	AFDB:A4JYR2	0.472	0.607	7.777E-11	161	0.114	0.149	A4JYR2.pdb.gz	A4JYR2_DANRE Novel immune-type receptor 14b OS=Danio rerio OX=7955 GN=si:dkey-149k8.5 PE=1 SV=1
8	AFDB:B8ZZZ4	0.530	0.558	1.431E-10	198	0.186	0.197	B8ZZZ4.pdb.gz	B8ZZZ4_HUMAN T-cell surface glycoprotein CD8 alpha chain OS=Homo sapiens OX=9606 GN=CD8A PE=1 SV=1
9	AFDB:F7FEU1	0.449	0.343	7.134E-10	285	0.214	0.158	F7FEU1.pdb.gz	F7FEU1_RAT V-set and immunoglobulin domain containing 4 OS=Rattus norvegicus OX=10116 GN=Vsig4 PE=1 SV=1
10	AFDB:O70153	0.417	0.386	1.111E-9	228	0.176	0.162	O70153.pdb.gz	O70153_RAT B29/Ig-beta/CD79b OS=Rattus norvegicus OX=10116 GN=Cd79b PE=4 SV=1
11	PDB:1igaA	0.477	0.218	1.727E-9	475	0.143	0.063	1igaA.pdb.gz
12	PDB:5c6wJ	0.443	0.393	1.929E-9	238	0.138	0.122	5c6wJ.pdb.gz
13	PDB:6hd8A	0.462	0.219	2.408E-9	461	0.157	0.072	6hd8A.pdb.gz	Structural basis for ion selectivity in TMEM175 K+channels.
14	PDB:1ct8A	0.443	0.435	2.843E-9	214	0.186	0.182	1ct8A.pdb.gz	Diverse structural solutions to catalysis in a family of antibodies.
15	PDB:4m62L	0.466	0.826	3.549E-9	113	0.138	0.257	4m62L.pdb.gz
16	PDB:1cd0A	0.449	0.815	4.948E-9	111	0.129	0.243	1cd0A.pdb.gz
17	PDB:1f6lL	0.439	0.831	4.948E-9	106	0.143	0.283	1f6lL.pdb.gz
18	PDB:4y5xB	0.459	0.832	6.528E-9	111	0.119	0.225	4y5xB.pdb.gz
19	PDB:5hhmI	0.417	0.445	7.293E-9	196	0.162	0.173	5hhmI.pdb.gz	Molecular basis for universal HLA-A*0201-restricted CD8+ T-cell immunity against influenza viruses.
20	PDB:4aizA	0.448	0.845	7.708E-9	107	0.114	0.224	4aizA.pdb.gz	Site-Directed Mutagenesis Reveals Regions Implicated in the Stability and Fiber Formation of Human Lambda3R Light Chains.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P10966	7.30e-157	434	210	1.000	1.000	CD8B_HUMAN T-cell surface glycoprotein CD8 beta chain OS=Homo sapiens OX=9606 GN=CD8B PE=1 SV=1
2	P10300	4.01e-54	174	213	0.500	0.493	CD8B_MOUSE T-cell surface glycoprotein CD8 beta chain OS=Mus musculus OX=10090 GN=Cd8b PE=1 SV=1
3	P0DSE1	6.93e-06	47.8	268	0.229	0.179	TRAR1_HUMAN M1-specific T cell receptor alpha chain OS=Homo sapiens OX=9606 GN=TRA PE=1 SV=1
4	P06328	4.87e-05	43.5	117	0.157	0.282	HVM49_MOUSE Ig heavy chain V region 1-72 OS=Mus musculus OX=10090 GN=Ighv1-72 PE=1 SV=2
5	A0A0C4DH25	6.77e-05	43.1	116	0.138	0.250	KVD20_HUMAN Immunoglobulin kappa variable 3D-20 OS=Homo sapiens OX=9606 GN=IGKV3D-20 PE=3 SV=1
6	P01619	8.77e-05	42.7	116	0.133	0.241	KV320_HUMAN Immunoglobulin kappa variable 3-20 OS=Homo sapiens OX=9606 GN=IGKV3-20 PE=1 SV=2
7	A0A8J8XPU7	1.14e-04	44.3	287	0.143	0.105	A0A8J8XPU7_RAT CD79b molecule OS=Rattus norvegicus OX=10116 GN=Cd79b PE=4 SV=1
8	O70153	1.18e-04	43.9	228	0.143	0.132	O70153_RAT B29/Ig-beta/CD79b OS=Rattus norvegicus OX=10116 GN=Cd79b PE=4 SV=1
9	A0A8I5Y5U3	1.19e-04	43.9	264	0.143	0.114	A0A8I5Y5U3_RAT CD79b molecule OS=Rattus norvegicus OX=10116 GN=Cd79b PE=4 SV=1
10	P01633	2.16e-04	42.4	149	0.152	0.215	KV5A1_MOUSE Immunoglobulin kappa chain variable 6-17 OS=Mus musculus OX=10090 GN=Igkv6-17 PE=1 SV=1
11	A0A075B6S6	2.33e-04	41.6	120	0.124	0.217	KVD30_HUMAN Immunoglobulin kappa variable 2D-30 OS=Homo sapiens OX=9606 GN=IGKV2D-30 PE=3 SV=1
12	P0DSE2	3.12e-04	43.1	310	0.181	0.123	TRBR1_HUMAN M1-specific T cell receptor beta chain OS=Homo sapiens OX=9606 GN=TRB PE=1 SV=1
13	P0DTU4	0.001	41.2	315	0.171	0.114	TRBR2_HUMAN T cell receptor beta chain MC.7.G5 OS=Homo sapiens OX=9606 GN=TRB PE=1 SV=1
14	A0A140T8N6	0.002	38.9	113	0.148	0.274	A0A140T8N6_MOUSE T cell receptor beta, variable 13-2 (Fragment) OS=Mus musculus OX=10090 GN=Trbv13-2 PE=4 SV=1
15	A0A0B4J1H6	0.003	38.9	120	0.124	0.217	A0A0B4J1H6_MOUSE Immunoglobulin kappa chain variable 2-137 (Fragment) OS=Mus musculus OX=10090 GN=Igkv2-137 PE=1 SV=1
16	P04433	0.003	38.5	115	0.133	0.243	KV311_HUMAN Immunoglobulin kappa variable 3-11 OS=Homo sapiens OX=9606 GN=IGKV3-11 PE=1 SV=1
17	A0A1D5P1T2	0.004	40.0	816	0.124	0.032	A0A1D5P1T2_CHICK MALT1 paracaspase OS=Gallus gallus OX=9031 GN=PCASP1 PE=4 SV=1
18	P01772	0.004	38.1	117	0.143	0.256	HV333_HUMAN Immunoglobulin heavy variable 3-33 OS=Homo sapiens OX=9606 GN=IGHV3-33 PE=1 SV=2
19	P40259	0.004	39.3	229	0.181	0.166	CD79B_HUMAN B-cell antigen receptor complex-associated protein beta chain OS=Homo sapiens OX=9606 GN=CD79B PE=1 SV=1
20	P01763	0.006	37.7	117	0.138	0.248	HV348_HUMAN Immunoglobulin heavy variable 3-48 OS=Homo sapiens OX=9606 GN=IGHV3-48 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07679 I-set	0.17	23.3	Immunoglobulin I-set domain
2	PF00047 ig	0.26	22.8	Immunoglobulin domain
3	PF13895 Ig_2	13	17.5	Immunoglobulin domain
4	PF13927 Ig_3	0.0028	29.5	Immunoglobulin domain
5	PF07686 V-set	1.2e-14	65.7	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000331172

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000386559	0.997	T-cell surface glycoprotein CD8 alpha chain
2	9606.ENSP00000300692	0.984	T-cell surface glycoprotein CD3 delta chain
3	9606.ENSP00000452780	0.978	Beta-2-microglobulin
4	9606.ENSP00000354566	0.974	T-cell surface glycoprotein CD3 epsilon chain
5	9606.ENSP00000264972	0.967	Tyrosine-protein kinase ZAP-70
6	9606.ENSP00000011653	0.965	T-cell surface glycoprotein CD4
7	9606.ENSP00000431445	0.963	T-cell surface glycoprotein CD3 gamma chain
8	9606.ENSP00000337825	0.953	Tyrosine-protein kinase Lck
9	9606.ENSP00000324890	0.948	T-cell-specific surface glycoprotein CD28
10	9606.ENSP00000354782	0.946	T-cell surface glycoprotein CD3 zeta chain
11	9606.ENSP00000216223	0.936	Interleukin-2 receptor subunit beta
12	9606.ENSP00000226730	0.936	Interleukin-2
13	9606.ENSP00000339186	0.930	GRB2-related adapter protein 2
14	9606.ENSP00000332049	0.929	T-lymphocyte activation antigen CD86
15	9606.ENSP00000369293	0.929	Interleukin-2 receptor subunit alpha
16	9606.ENSP00000363318	0.928	Cytokine receptor common subunit gamma
17	9606.ENSP00000295756	0.927	T-cell receptor-associated transmembrane adapter 1
18	9606.ENSP00000379873	0.923	HLA class I histocompatibility antigen, A-3 alpha chain
19	9606.ENSP00000264246	0.921	T-lymphocyte activation antigen CD80
20	9606.ENSP00000364907	0.919	Tyrosine-protein kinase SYK

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0007165	0.998	signal transduction
GO:0002376	0.997	immune system process
GO:0045321	0.993	leukocyte activation
GO:0050778	0.993	positive regulation of immune response
GO:0002768	0.976	immune response-regulating cell surface receptor signaling pathway
GO:0050851	0.965	antigen receptor-mediated signaling pathway
GO:0042110	0.926	T cell activation
GO:0050852	0.818	T cell receptor signaling pathway

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0012505	0.986	endomembrane system
GO:0043231	0.983	intracellular membrane-bounded organelle
GO:0005737	0.953	cytoplasm
GO:0031982	0.865	vesicle
GO:0097708	0.839	intracellular vesicle
GO:0031410	0.821	cytoplasmic vesicle
GO:0009986	0.697	cell surface
GO:0031090	0.485	organelle membrane
GO:0010008	0.406	endosome membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]