StarFunc result for job id P10997

User Input

>input (89 residues)
MGILKLQVFLIVLSVALNHLKATPIESHQVEKRKCNTATCATQRLANFLVHSSNNFGAIL
SSTNVGSNTYGKRNAVEVLKREPLNYLPL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P10997	1.000	1.000	3.202E-14	89	1.000	1.000	P10997.pdb.gz	IAPP_HUMAN Islet amyloid polypeptide OS=Homo sapiens OX=9606 GN=IAPP PE=1 SV=1
2	PDB:6ucjA	0.665	0.860	1.348E-9	67	0.753	1.000	6ucjA.pdb.gz
3	AFDB:P12968	0.519	0.500	1.508E-7	93	0.652	0.624	P12968.pdb.gz	IAPP_MOUSE Islet amyloid polypeptide OS=Mus musculus OX=10090 GN=Iapp PE=3 SV=1
4	AFDB:Q6DGJ9	0.233	0.176	3.559E-1	126	0.360	0.254	Q6DGJ9.pdb.gz	Q6DGJ9_DANRE Calca protein OS=Danio rerio OX=7955 GN=calc PE=2 SV=1
5	AFDB:P46639	0.273	0.062	2.833	398	0.202	0.045	P46639.pdb.gz	KNAT1_ARATH Homeobox protein knotted-1-like 1 OS=Arabidopsis thaliana OX=3702 GN=KNAT1 PE=1 SV=1
6	AFDB:Q9VET0	0.266	0.234	2.833	102	0.135	0.118	Q9VET0.pdb.gz	NPF_DROME Neuropeptide F OS=Drosophila melanogaster OX=7227 GN=NPF PE=1 SV=1
7	PDB:6wooL	0.232	0.107	4.700	198	0.112	0.051	6wooL.pdb.gz	An active role of the eukaryotic large ribosomal subunit in translation initiation fidelity.
8	PDB:4v8mBr	0.185	0.068	5.481	367	0.112	0.027	4v8mBr.pdb.gz	High-Resolution Cryo-Electron Microscopy Structure of the Trypanosoma Brucei Ribosome.
9	AFDB:Q8I716	0.228	0.042	6.108	749	0.225	0.027	Q8I716.pdb.gz	Q8I716_PLAF7 methionine--tRNA ligase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1005000 PE=3 SV=1
10	PDB:6vz1A	0.277	0.084	6.391	411	0.067	0.015	6vz1A.pdb.gz	Structure and catalytic mechanism of a human triacylglycerol-synthesis enzyme.
11	PDB:1o8tA	0.225	0.245	6.902	79	0.101	0.114	1o8tA.pdb.gz
12	AFDB:O81315	0.234	0.089	7.123	257	0.079	0.027	O81315.pdb.gz	O81315_ARATH Calcium-binding EF-hand family protein OS=Arabidopsis thaliana OX=3702 GN=EDA34 PE=4 SV=1
13	PDB:6h68M	0.196	0.062	7.453	396	0.101	0.023	6h68M.pdb.gz	Structural basis of RNA polymerase I stalling at UV light-induced DNA damage.
14	PDB:7pzyt	0.250	0.138	7.453	200	0.112	0.050	7pzyt.pdb.gz	E-site drug specificity of the human pathogen Candida albicans ribosome.
15	PDB:6hivCH	0.146	0.077	8.048	273	0.067	0.022	6hivCH.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
16	AFDB:Q387Z2	0.272	0.058	8.305	660	0.090	0.012	Q387Z2.pdb.gz	Q387Z2_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.61.1320 PE=4 SV=1
17	PDB:4v96AA	0.191	0.080	8.691	299	0.112	0.033	4v96AA.pdb.gz
18	PDB:6yxyAE	0.157	0.051	8.691	434	0.045	0.009	6yxyAE.pdb.gz	Structural Insights into the Mechanism of Mitoribosomal Large Subunit Biogenesis.
19	AFDB:M0R063	0.221	0.056	8.969	486	0.090	0.016	M0R063.pdb.gz	M0R063_HUMAN Amino acid transporter OS=Homo sapiens OX=9606 GN=SLC1A6 PE=1 SV=1
20	AFDB:Q9VKK5	0.280	0.211	8.969	122	0.101	0.074	Q9VKK5.pdb.gz	Q9VKK5_DROME Allatostatin C, isoform A OS=Drosophila melanogaster OX=7227 GN=AstC PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P10997	7.46e-61	181	89	1.000	1.000	IAPP_HUMAN Islet amyloid polypeptide OS=Homo sapiens OX=9606 GN=IAPP PE=1 SV=1
2	P12968	4.21e-36	119	93	0.674	0.645	IAPP_MOUSE Islet amyloid polypeptide OS=Mus musculus OX=10090 GN=Iapp PE=3 SV=1
3	P12969	8.68e-35	115	93	0.652	0.624	IAPP_RAT Islet amyloid polypeptide OS=Rattus norvegicus OX=10116 GN=Iapp PE=1 SV=1
4	D3Y4D2	2.48e-11	55.1	37	0.303	0.730	D3Y4D2_PIG Islet amyloid polypeptide (Fragment) OS=Sus scrofa OX=9823 GN=IAPP PE=1 SV=1
5	Q6DGJ9	1.57e-08	50.1	126	0.281	0.198	Q6DGJ9_DANRE Calca protein OS=Danio rerio OX=7955 GN=calc PE=2 SV=1
6	P10092	1.01e-07	48.1	127	0.281	0.197	CALCB_HUMAN Calcitonin gene-related peptide 2 OS=Homo sapiens OX=9606 GN=CALCB PE=1 SV=1
7	P06881	6.26e-07	45.8	128	0.303	0.211	CALCA_HUMAN Calcitonin gene-related peptide 1 OS=Homo sapiens OX=9606 GN=CALCA PE=1 SV=4
8	Q99JA0	1.81e-06	44.7	128	0.236	0.164	CALCA_MOUSE Calcitonin gene-related peptide 1 OS=Mus musculus OX=10090 GN=Calca PE=2 SV=1
9	P01256	1.85e-06	44.7	128	0.236	0.164	CALCA_RAT Calcitonin gene-related peptide 1 OS=Rattus norvegicus OX=10116 GN=Calca PE=2 SV=1
10	Q9LZ72	0.012	35.4	464	0.213	0.041	KCS19_ARATH 3-ketoacyl-CoA synthase 19 OS=Arabidopsis thaliana OX=3702 GN=KCS19 PE=2 SV=1
11	P30880	0.031	32.0	37	0.180	0.432	CALCA_PIG Calcitonin gene-related peptide OS=Sus scrofa OX=9823 GN=CALCA PE=1 SV=1
12	Q96HY7	0.79	30.0	919	0.258	0.025	DHTK1_HUMAN 2-oxoadipate dehydrogenase complex component E1 OS=Homo sapiens OX=9606 GN=DHTKD1 PE=1 SV=2
13	A0A1W6I187	3.2	28.1	181	0.191	0.094	CAPS1_SPV1 Capsid protein VP4 OS=Sulfolobus polyhedral virus 1 OX=1982658 GN=ORF43 PE=1 SV=1
14	A2ATU0	7.2	27.3	921	0.326	0.031	DHTK1_MOUSE 2-oxoadipate dehydrogenase complex component E1 OS=Mus musculus OX=10090 GN=Dhtkd1 PE=1 SV=1
15	Q08AL9	7.2	27.3	531	0.191	0.032	Q08AL9_HUMAN STXBP4 protein OS=Homo sapiens OX=9606 GN=STXBP4 PE=1 SV=1
16	Q6ZWJ1	7.2	27.3	553	0.191	0.031	STXB4_HUMAN Syntaxin-binding protein 4 OS=Homo sapiens OX=9606 GN=STXBP4 PE=1 SV=2
17	Q9LH79	7.9	27.3	236	0.135	0.051	SWET2_ARATH Bidirectional sugar transporter SWEET2 OS=Arabidopsis thaliana OX=3702 GN=SWEET2 PE=1 SV=1
18	Q8C5H1	8.9	27.3	955	0.101	0.009	ANO4_MOUSE Anoctamin-4 OS=Mus musculus OX=10090 GN=Ano4 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00214 Calc_CGRP_IAPP	2.7e-13	62.0	Calcitonin / CGRP / IAPP family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000240652

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000380432	0.995	Insulin
2	9606.ENSP00000352561	0.992	Calcitonin receptor
3	9606.ENSP00000265986	0.987	Insulin-degrading enzyme
4	9606.ENSP00000312652	0.984	Leptin
5	9606.ENSP00000254661	0.975	Receptor activity-modifying protein 1
6	9606.ENSP00000331746	0.973	Calcitonin
7	9606.ENSP00000370421	0.971	Pancreas/duodenum homeobox protein 1
8	9606.ENSP00000242249	0.968	Receptor activity-modifying protein 3
9	9606.ENSP00000386972	0.966	Calcitonin gene-related peptide type 1 receptor
10	9606.ENSP00000433490	0.964	Calcitonin gene-related peptide 2
11	9606.ENSP00000436607	0.957	ADM
12	9606.ENSP00000253796	0.947	Receptor activity-modifying protein 2
13	9606.ENSP00000387662	0.904	Glucagon
14	9606.ENSP00000338345	0.873	Alpha-synuclein
15	9606.ENSP00000379087	0.854	ADM2
16	9606.ENSP00000237014	0.850	Transthyretin
17	9606.ENSP00000379472	0.803	Cholecystokinin
18	9606.ENSP00000284981	0.802	Amyloid-beta A4 protein
19	9606.ENSP00000353198	0.790	Peptide YY
20	9606.ENSP00000340820	0.779	Microtubule-associated protein tau

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005102	0.999	signaling receptor binding
GO:0001540	0.999	amyloid-beta binding
GO:0042802	0.997	identical protein binding
GO:0008289	0.995	lipid binding
GO:0001664	0.621	G protein-coupled receptor binding
GO:0098772	0.560	molecular function regulator activity
GO:0140677	0.492	molecular function activator activity
GO:0048018	0.426	receptor ligand activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.997	regulation of biological process
GO:0050794	0.993	regulation of cellular process
GO:0023052	0.985	signaling
GO:0051716	0.985	cellular response to stimulus
GO:0007165	0.979	signal transduction
GO:0048518	0.972	positive regulation of biological process
GO:0048519	0.963	negative regulation of biological process
GO:0007186	0.934	G protein-coupled receptor signaling pathway
GO:0032879	0.921	regulation of localization
GO:0048523	0.908	negative regulation of cellular process
GO:0019222	0.894	regulation of metabolic process
GO:0060255	0.875	regulation of macromolecule metabolic process
GO:0051049	0.867	regulation of transport
GO:0048522	0.865	positive regulation of cellular process
GO:0032501	0.737	multicellular organismal process
GO:0080090	0.720	regulation of primary metabolic process
GO:0007267	0.714	cell-cell signaling
GO:0009893	0.690	positive regulation of metabolic process
GO:0051171	0.685	regulation of nitrogen compound metabolic process
GO:0065008	0.673	regulation of biological quality
GO:0010604	0.662	positive regulation of macromolecule metabolic process
GO:0010646	0.657	regulation of cell communication
GO:0023051	0.656	regulation of signaling
GO:0048583	0.655	regulation of response to stimulus
GO:0071704	0.647	organic substance metabolic process
GO:0044238	0.634	primary metabolic process
GO:0051050	0.555	positive regulation of transport
GO:0007189	0.542	adenylate cyclase-activating G protein-coupled receptor signaling pathway
GO:0009966	0.540	regulation of signal transduction
GO:0051246	0.532	regulation of protein metabolic process
GO:0031323	0.518	regulation of cellular metabolic process
GO:0031325	0.488	positive regulation of cellular metabolic process
GO:0051247	0.454	positive regulation of protein metabolic process
GO:0043269	0.422	regulation of monoatomic ion transport
GO:0010647	0.415	positive regulation of cell communication
GO:0023056	0.412	positive regulation of signaling
GO:0010941	0.379	regulation of cell death
GO:0048584	0.378	positive regulation of response to stimulus
GO:1902531	0.373	regulation of intracellular signal transduction
GO:0034762	0.369	regulation of transmembrane transport
GO:0051239	0.359	regulation of multicellular organismal process
GO:0071840	0.357	cellular component organization or biogenesis
GO:0010468	0.354	regulation of gene expression
GO:0010959	0.345	regulation of metal ion transport
GO:0006807	0.340	nitrogen compound metabolic process
GO:0051924	0.339	regulation of calcium ion transport
GO:0032502	0.331	developmental process
GO:0009892	0.324	negative regulation of metabolic process
GO:0016043	0.316	cellular component organization
GO:1901564	0.315	organonitrogen compound metabolic process
GO:0043170	0.309	macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005622	1.000	intracellular anatomical structure
GO:0005576	1.000	extracellular region
GO:0016234	0.796	inclusion body
GO:0005737	0.771	cytoplasm
GO:0043229	0.765	intracellular organelle
GO:0043231	0.746	intracellular membrane-bounded organelle
GO:0005615	0.637	extracellular space

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]