StarFunc result for job id P11047

User Input

>input (1609 residues)
MRGSHRAAPALRPRGRLWPVLAVLAAAAAAGCAQAAMDECTDEGGRPQRCMPEFVNAAFN
VTVVATNTCGTPPEEYCVQTGVTGVTKSCHLCDAGQPHLQHGAAFLTDYNNQADTTWWQS
QTMLAGVQYPSSINLTLHLGKAFDITYVRLKFHTSRPESFAIYKRTREDGPWIPYQYYSG
SCENTYSKANRGFIRTGGDEQQALCTDEFSDISPLTGGNVAFSTLEGRPSAYNFDNSPVL
QEWVTATDIRVTLNRLNTFGDEVFNDPKVLKSYYYAISDFAVGGRCKCNGHASECMKNEF
DKLVCNCKHNTYGVDCEKCLPFFNDRPWRRATAESASECLPCDCNGRSQECYFDPELYRS
TGHGGHCTNCQDNTDGAHCERCRENFFRLGNNEACSSCHCSPVGSLSTQCDSYGRCSCKP
GVMGDKCDRCQPGFHSLTEAGCRPCSCDPSGSIDECNIETGRCVCKDNVEGFNCERCKPG
FFNLESSNPRGCTPCFCFGHSSVCTNAVGYSVYSISSTFQIDEDGWRAEQRDGSEASLEW
SSERQDIAVISDSYFPRYFIAPAKFLGKQVLSYGQNLSFSFRVDRRDTRLSAEDLVLEGA
GLRVSVPLIAQGNSYPSETTVKYVFRLHEATDYPWRPALTPFEFQKLLNNLTSIKIRGTY
SERSAGYLDDVTLASARPGPGVPATWVESCTCPVGYGGQFCEMCLSGYRRETPNLGPYSP
CVLCACNGHSETCDPETGVCNCRDNTAGPHCEKCSDGYYGDSTAGTSSDCQPCPCPGGSS
CAVVPKTKEVVCTNCPTGTTGKRCELCDDGYFGDPLGRNGPVRLCRLCQCSDNIDPNAVG
NCNRLTGECLKCIYNTAGFYCDRCKDGFFGNPLAPNPADKCKACNCNLYGTMKQQSSCNP
VTGQCECLPHVTGQDCGACDPGFYNLQSGQGCERCDCHALGSTNGQCDIRTGQCECQPGI
TGQHCERCEVNHFGFGPEGCKPCDCHPEGSLSLQCKDDGRCECREGFVGNRCDQCEENYF
YNRSWPGCQECPACYRLVKDKVADHRVKLQELESLIANLGTGDEMVTDQAFEDRLKEAER
EVMDLLREAQDVKDVDQNLMDRLQRVNNTLSSQISRLQNIRNTIEETGNLAEQARAHVEN
TERLIEIASRELEKAKVAAANVSVTQPESTGDPNNMTLLAEEARKLAERHKQEADDIVRV
AKTANDTSTEAYNLLLRTLAGENQTAFEIEELNRKYEQAKNISQDLEKQAARVHEEAKRA
GDKAVEIYASVAQLSPLDSETLENEANNIKMEAENLEQLIDQKLKDYEDLREDMRGKELE
VKNLLEKGKTEQQTADQLLARADAAKALAEEAAKKGRDTLQEANDILNNLKDFDRRVNDN
KTAAEEALRKIPAINQTITEANEKTREAQQALGSAAADATEAKNKAHEAERIASAVQKNA
TSTKAEAERTFAEVTDLDNEVNNMLKQLQEAEKELKRKQDDADQDMMMAGMASQAAQEAE
INARKAKNSVTSLLSIINDLLEQLGQLDTVDLNKLNEIEGTLNKAKDEMKVSDLDRKVSD
LENEAKKQEAAIMDYNRDIEEIMKDIRNLEDIRKTLPSGCFNTPSIEKP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1QPJ1	0.216	0.211	0.000	1643	0.421	0.412	F1QPJ1.pdb.gz	F1QPJ1_DANRE Laminin subunit gamma-3 OS=Danio rerio OX=7955 GN=lamc3 PE=4 SV=1
2	AFDB:P11047	1.000	1.000	0.000	1609	1.000	1.000	P11047.pdb.gz	LAMC1_HUMAN Laminin subunit gamma-1 OS=Homo sapiens OX=9606 GN=LAMC1 PE=1 SV=3
3	AFDB:Q18823	0.250	0.247	0.000	1633	0.391	0.385	Q18823.pdb.gz	LAM2_CAEEL Laminin-like protein lam-2 OS=Caenorhabditis elegans OX=6239 GN=lam-2 PE=1 SV=3
4	AFDB:Q1LVF0	0.343	0.346	0.000	1593	0.683	0.690	Q1LVF0.pdb.gz	LAMC1_DANRE Laminin subunit gamma-1 OS=Danio rerio OX=7955 GN=lamc1 PE=2 SV=2
5	AFDB:Q9R0B6	0.323	0.328	0.000	1581	0.420	0.427	Q9R0B6.pdb.gz	LAMC3_MOUSE Laminin subunit gamma-3 OS=Mus musculus OX=10090 GN=Lamc3 PE=1 SV=2
6	AFDB:Q9Y6N6	0.257	0.261	0.000	1575	0.426	0.435	Q9Y6N6.pdb.gz	LAMC3_HUMAN Laminin subunit gamma-3 OS=Homo sapiens OX=9606 GN=LAMC3 PE=1 SV=3
7	AFDB:F1LRH4	0.223	0.296	5.096E-93	1192	0.307	0.414	F1LRH4.pdb.gz	F1LRH4_RAT Laminin subunit gamma 2 OS=Rattus norvegicus OX=10116 GN=Lamc2 PE=4 SV=1
8	AFDB:P11046	0.224	0.203	8.324E-81	1788	0.264	0.237	P11046.pdb.gz	LAMB1_DROME Laminin subunit beta-1 OS=Drosophila melanogaster OX=7227 GN=LanB1 PE=1 SV=4
9	AFDB:D3ZQN7	0.251	0.228	5.091E-80	1786	0.266	0.240	D3ZQN7.pdb.gz	D3ZQN7_RAT Laminin subunit beta 1 OS=Rattus norvegicus OX=10116 GN=Lamb1 PE=1 SV=3
10	AFDB:Q90922	0.236	0.592	1.320E-57	606	0.139	0.370	Q90922.pdb.gz	NET1_CHICK Netrin-1 OS=Gallus gallus OX=9031 GN=NTN1 PE=1 SV=1
11	PDB:1xpwA	0.058	0.544	2.487E-3	143	0.012	0.140	1xpwA.pdb.gz
12	PDB:2waaA	0.061	0.242	3.424E-3	335	0.010	0.048	2waaA.pdb.gz
13	PDB:1o59A	0.067	0.290	3.611E-3	318	0.016	0.079	1o59A.pdb.gz
14	PDB:1k12A	0.073	0.630	4.713E-3	158	0.013	0.133	1k12A.pdb.gz	A novel fucose recognition fold involved in innate immunity.
15	PDB:8a3tA	0.059	0.383	5.831E-3	219	0.013	0.096	8a3tA.pdb.gz	Cryo-EM structure of the S. cerevisiae APC/C-Cdh1 complex
16	PDB:4bxsV	0.072	0.089	1.985E-2	1262	0.016	0.020	4bxsV.pdb.gz	Crystal Structure of the Prothrombinase Complex from the Venom of Pseudonaja Textilis.
17	PDB:7ufgA	0.058	0.073	1.985E-2	1151	0.043	0.060	7ufgA.pdb.gz	Structure of the PAPP-ABP5 complex reveals mechanism of substrate recognition
18	PDB:6mdsA	0.071	0.140	3.040E-2	787	0.012	0.024	6mdsA.pdb.gz	Molecular Basis of Broad SpectrumN-Glycan Specificity and Processing of Therapeutic IgG Monoclonal Antibodies by Endoglycosidase S2.
19	PDB:4pxqA	0.068	0.177	8.362E-2	516	0.014	0.045	4pxqA.pdb.gz	Structural and Functional Study of d-Glucuronyl C5-epimerase.
20	PDB:7kveB	0.073	0.085	9.302E-2	1374	0.015	0.017	7kveB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1LRH4	0.0	665	1192	0.195	0.263	F1LRH4_RAT Laminin subunit gamma 2 OS=Rattus norvegicus OX=10116 GN=Lamc2 PE=4 SV=1
2	F1MAA7	0.0	3039	1607	0.912	0.914	F1MAA7_RAT Laminin subunit gamma 1 OS=Rattus norvegicus OX=10116 GN=Lamc1 PE=1 SV=1
3	F1MD77	0.0	3113	1608	0.947	0.947	F1MD77_BOVIN Laminin subunit gamma 1 OS=Bos taurus OX=9913 GN=LAMC1 PE=1 SV=2
4	F1QPJ1	0.0	1252	1643	0.424	0.415	F1QPJ1_DANRE Laminin subunit gamma-3 OS=Danio rerio OX=7955 GN=lamc3 PE=4 SV=1
5	P02468	0.0	3062	1607	0.926	0.927	LAMC1_MOUSE Laminin subunit gamma-1 OS=Mus musculus OX=10090 GN=Lamc1 PE=1 SV=2
6	P11047	0.0	3341	1609	1.000	1.000	LAMC1_HUMAN Laminin subunit gamma-1 OS=Homo sapiens OX=9606 GN=LAMC1 PE=1 SV=3
7	P15215	0.0	1245	1639	0.410	0.402	LAMC1_DROME Laminin subunit gamma-1 OS=Drosophila melanogaster OX=7227 GN=LanB2 PE=2 SV=2
8	Q13753	0.0	679	1193	0.202	0.272	LAMC2_HUMAN Laminin subunit gamma-2 OS=Homo sapiens OX=9606 GN=LAMC2 PE=1 SV=2
9	Q18823	0.0	1181	1633	0.399	0.393	LAM2_CAEEL Laminin-like protein lam-2 OS=Caenorhabditis elegans OX=6239 GN=lam-2 PE=1 SV=3
10	Q1LVF0	0.0	2263	1593	0.683	0.690	LAMC1_DANRE Laminin subunit gamma-1 OS=Danio rerio OX=7955 GN=lamc1 PE=2 SV=2
11	Q61092	0.0	670	1191	0.196	0.265	LAMC2_MOUSE Laminin subunit gamma-2 OS=Mus musculus OX=10090 GN=Lamc2 PE=1 SV=2
12	Q9R0B6	0.0	1288	1581	0.424	0.432	LAMC3_MOUSE Laminin subunit gamma-3 OS=Mus musculus OX=10090 GN=Lamc3 PE=1 SV=2
13	Q9Y6N6	0.0	1343	1575	0.431	0.440	LAMC3_HUMAN Laminin subunit gamma-3 OS=Homo sapiens OX=9606 GN=LAMC3 PE=1 SV=3
14	P19137	4.06e-172	579	3083	0.240	0.125	LAMA1_MOUSE Laminin subunit alpha-1 OS=Mus musculus OX=10090 GN=Lama1 PE=1 SV=2
15	P25391	6.67e-168	567	3075	0.237	0.124	LAMA1_HUMAN Laminin subunit alpha-1 OS=Homo sapiens OX=9606 GN=LAMA1 PE=1 SV=2
16	P24043	6.70e-167	564	3122	0.236	0.121	LAMA2_HUMAN Laminin subunit alpha-2 OS=Homo sapiens OX=9606 GN=LAMA2 PE=1 SV=4
17	G8IHU0	9.77e-167	563	3078	0.231	0.121	G8IHU0_DANRE Laminin alpha 2 chain short splice variant OS=Danio rerio OX=7955 GN=Lama2 PE=1 SV=1
18	F1MMT2	1.20e-165	552	1964	0.237	0.195	F1MMT2_BOVIN Laminin subunit alpha 2 OS=Bos taurus OX=9913 GN=LAMA2 PE=4 SV=3
19	Q60675	9.03e-165	558	3118	0.232	0.120	LAMA2_MOUSE Laminin subunit alpha-2 OS=Mus musculus OX=10090 GN=Lama2 PE=1 SV=2
20	F1M614	2.75e-164	556	3117	0.230	0.119	F1M614_RAT Laminin subunit alpha 2 OS=Rattus norvegicus OX=10116 GN=Lama2 PE=4 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00052 Laminin_B	1e-25	101.6	Laminin B (Domain IV)
2	PF00053 Laminin_EGF	3.4e-82	281.7	Laminin EGF domain
3	PF00055 Laminin_N	5.9e-79	276.4	Laminin N-terminal (Domain VI)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000258341

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000222399	0.999	Laminin subunit beta-1
2	9606.ENSP00000252999	0.999	Laminin subunit alpha-5
3	9606.ENSP00000264187	0.998	Nidogen-1
4	9606.ENSP00000388325	0.990	Laminin subunit beta-2
5	9606.ENSP00000324532	0.987	Laminin subunit alpha-3
6	9606.ENSP00000216286	0.970	Nidogen-2
7	9606.ENSP00000442600	0.970	Dystroglycan
8	9606.ENSP00000379350	0.969	Integrin beta-1
9	9606.ENSP00000007722	0.958	Integrin alpha-3
10	9606.ENSP00000200181	0.953	Integrin beta-4
11	9606.ENSP00000261023	0.950	Integrin alpha-V
12	9606.ENSP00000386896	0.948	Integrin alpha-6
13	9606.ENSP00000375778	0.946	Laminin subunit beta-3
14	9606.ENSP00000452120	0.943	Integrin alpha-7
15	9606.ENSP00000452786	0.940	Integrin beta-3
16	9606.ENSP00000296585	0.939	Integrin alpha-2
17	9606.ENSP00000374309	0.939	Laminin subunit alpha-1
18	9606.ENSP00000282588	0.938	Integrin alpha-1
19	9606.ENSP00000230538	0.937	Laminin subunit alpha-4
20	9606.ENSP00000400365	0.934	Laminin subunit alpha-2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005201	1.000	extracellular matrix structural constituent
GO:0097367	0.998	carbohydrate derivative binding
GO:0005515	0.995	protein binding
GO:0051861	0.790	glycolipid binding
GO:0046625	0.731	sphingolipid binding
GO:0043208	0.716	glycosphingolipid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0032501	0.997	multicellular organismal process
GO:0048856	0.997	anatomical structure development
GO:0048869	0.985	cellular developmental process
GO:0007275	0.984	multicellular organism development
GO:0030154	0.979	cell differentiation
GO:0050789	0.976	regulation of biological process
GO:0048513	0.975	animal organ development
GO:0048731	0.971	system development
GO:0071840	0.955	cellular component organization or biogenesis
GO:0009653	0.950	anatomical structure morphogenesis
GO:0016043	0.932	cellular component organization
GO:0050794	0.913	regulation of cellular process
GO:0009888	0.876	tissue development
GO:0007399	0.863	nervous system development
GO:0050896	0.831	response to stimulus
GO:0048468	0.818	cell development
GO:0048518	0.770	positive regulation of biological process
GO:0022008	0.757	neurogenesis
GO:0007155	0.730	cell adhesion
GO:0048522	0.692	positive regulation of cellular process
GO:0031589	0.613	cell-substrate adhesion
GO:0009790	0.550	embryo development
GO:0060429	0.519	epithelium development
GO:0043588	0.516	skin development
GO:0030030	0.515	cell projection organization
GO:0120036	0.508	plasma membrane bounded cell projection organization
GO:0048870	0.497	cell motility
GO:0048666	0.475	neuron development
GO:0016477	0.429	cell migration
GO:0022607	0.310	cellular component assembly
GO:0008152	0.305	metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.999	extracellular region
GO:0062023	0.998	collagen-containing extracellular matrix
GO:0032991	0.996	protein-containing complex
GO:0005604	0.992	basement membrane
GO:0043256	0.941	laminin complex
GO:0005886	0.909	plasma membrane
GO:0031982	0.863	vesicle
GO:0005622	0.833	intracellular anatomical structure
GO:0043231	0.795	intracellular membrane-bounded organelle
GO:0012505	0.756	endomembrane system
GO:0005737	0.742	cytoplasm
GO:0005615	0.741	extracellular space
GO:0030054	0.673	cell junction
GO:0043233	0.574	organelle lumen
GO:0005783	0.498	endoplasmic reticulum
GO:0070013	0.473	intracellular organelle lumen
GO:0043260	0.388	laminin-11 complex
GO:0043259	0.370	laminin-10 complex
GO:0005606	0.369	laminin-1 complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]