StarFunc result for job id P11049

User Input

>input (281 residues)
MSAQESCLSLIKYFLFVFNLFFFVLGSLIFCFGIWILIDKTSFVSFVGLAFVPLQIWSKV
LAISGIFTMGIALLGCVGALKELRCLLGLYFGMLLLLFATQITLGILISTQRAQLERSLR
DVVEKTIQKYGTNPEETAAEESWDYVQFQLRCCGWHYPQDWFQVLILRGNGSEAHRVPCS
CYNLSATNDSTILDKVILPQLSRLGHLARSRHSADICAVPAESHIYREGCAQGLQKWLHN
NLISIVGICLGVGLLELGFMTLSIFLCRNLDHVYNRLARYR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P11049	1.000	1.000	9.655E-43	281	1.000	1.000	P11049.pdb.gz	CD37_HUMAN Leukocyte antigen CD37 OS=Homo sapiens OX=9606 GN=CD37 PE=1 SV=2
2	AFDB:Q61470	0.953	0.953	4.183E-35	281	0.801	0.801	Q61470.pdb.gz	CD37_MOUSE Leukocyte antigen CD37 OS=Mus musculus OX=10090 GN=Cd37 PE=1 SV=1
3	AFDB:P27701	0.793	0.833	3.673E-18	267	0.352	0.371	P27701.pdb.gz	CD82_HUMAN CD82 antigen OS=Homo sapiens OX=9606 GN=CD82 PE=1 SV=1
4	AFDB:Q96FV3	0.696	0.723	9.447E-13	270	0.238	0.248	Q96FV3.pdb.gz	TSN17_HUMAN Tetraspanin-17 OS=Homo sapiens OX=9606 GN=TSPAN17 PE=2 SV=2
5	AFDB:O14817	0.725	0.848	1.499E-12	238	0.238	0.282	O14817.pdb.gz	TSN4_HUMAN Tetraspanin-4 OS=Homo sapiens OX=9606 GN=TSPAN4 PE=1 SV=1
6	AFDB:Q9H1Z9	0.693	0.559	2.772E-12	355	0.281	0.223	Q9H1Z9.pdb.gz	TSN10_HUMAN Tetraspanin-10 OS=Homo sapiens OX=9606 GN=TSPAN10 PE=2 SV=1
7	AFDB:Q22495	0.698	0.641	3.969E-12	308	0.249	0.227	Q22495.pdb.gz	TSP12_CAEEL Tetraspanin-12 OS=Caenorhabditis elegans OX=6239 GN=tsp-12 PE=1 SV=1
8	AFDB:Q9V3X2	0.635	0.661	4.178E-12	268	0.242	0.254	Q9V3X2.pdb.gz	Q9V3X2_DROME Tetraspanin OS=Drosophila melanogaster OX=7227 GN=Tsp96F PE=1 SV=1
9	AFDB:O60635	0.666	0.762	5.683E-12	241	0.238	0.278	O60635.pdb.gz	TSN1_HUMAN Tetraspanin-1 OS=Homo sapiens OX=9606 GN=TSPAN1 PE=1 SV=2
10	AFDB:P62079	0.701	0.733	5.683E-12	268	0.238	0.250	P62079.pdb.gz	TSN5_HUMAN Tetraspanin-5 OS=Homo sapiens OX=9606 GN=TSPAN5 PE=1 SV=1
11	PDB:6wvgA	0.638	0.414	1.854E-9	443	0.238	0.151	6wvgA.pdb.gz
12	PDB:6k4jA	0.494	0.610	4.433E-9	220	0.210	0.268	6k4jA.pdb.gz
13	PDB:5tcxA	0.469	0.599	6.740E-7	208	0.199	0.269	5tcxA.pdb.gz	Crystal Structure of a Full-Length Human Tetraspanin Reveals a Cholesterol-Binding Pocket.
14	PDB:7zw1A	0.396	0.358	1.125E-6	317	0.153	0.136	7zw1A.pdb.gz
15	PDB:7zw1B	0.413	0.379	7.534E-5	316	0.185	0.165	7zw1B.pdb.gz
16	PDB:7stmA	0.196	0.089	3.741E-1	801	0.160	0.056	7stmA.pdb.gz	Structural basis for inhibition and regulation of a chitin synthase from Candida albicans.
17	PDB:5nl2A	0.145	0.107	1.348	434	0.121	0.078	5nl2A.pdb.gz
18	PDB:6r7xA	0.152	0.085	2.031	629	0.139	0.062	6r7xA.pdb.gz	The structural basis of lipid scrambling and inactivation in the endoplasmic reticulum scramblase TMEM16K.
19	PDB:7wvuR	0.158	0.150	2.138	298	0.139	0.131	7wvuR.pdb.gz	Structural basis of FPR2 in recognition of A beta 42 and neuroprotection by humanin.
20	PDB:7ungA0	0.148	0.182	2.369	220	0.089	0.114	7ungA0.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P11049	0.0	573	281	1.000	1.000	CD37_HUMAN Leukocyte antigen CD37 OS=Homo sapiens OX=9606 GN=CD37 PE=1 SV=2
2	Q61470	8.34e-159	444	281	0.801	0.801	CD37_MOUSE Leukocyte antigen CD37 OS=Mus musculus OX=10090 GN=Cd37 PE=1 SV=1
3	P27701	1.40e-45	156	267	0.352	0.371	CD82_HUMAN CD82 antigen OS=Homo sapiens OX=9606 GN=CD82 PE=1 SV=1
4	Q61451	3.15e-24	99.4	219	0.206	0.265	CD53_MOUSE Leukocyte surface antigen CD53 OS=Mus musculus OX=10090 GN=Cd53 PE=2 SV=2
5	P24485	1.52e-22	94.7	219	0.206	0.265	CD53_RAT Leukocyte surface antigen CD53 OS=Rattus norvegicus OX=10116 GN=Cd53 PE=1 SV=3
6	Q9V3E5	2.11e-20	90.1	267	0.253	0.266	Q9V3E5_DROME Tetraspanin OS=Drosophila melanogaster OX=7227 GN=Tsp66E PE=2 SV=1
7	Q9V3X2	3.04e-20	89.7	268	0.238	0.250	Q9V3X2_DROME Tetraspanin OS=Drosophila melanogaster OX=7227 GN=Tsp96F PE=1 SV=1
8	P19397	3.34e-20	88.6	219	0.203	0.260	CD53_HUMAN Leukocyte surface antigen CD53 OS=Homo sapiens OX=9606 GN=CD53 PE=1 SV=1
9	A0A0B4KH03	3.58e-20	89.7	284	0.238	0.236	A0A0B4KH03_DROME Tetraspanin OS=Drosophila melanogaster OX=7227 GN=Tsp96F PE=1 SV=1
10	P62079	3.99e-19	86.7	268	0.263	0.276	TSN5_HUMAN Tetraspanin-5 OS=Homo sapiens OX=9606 GN=TSPAN5 PE=1 SV=1
11	P62080	3.99e-19	86.7	268	0.263	0.276	TSN5_MOUSE Tetraspanin-5 OS=Mus musculus OX=10090 GN=Tspan5 PE=1 SV=1
12	Q68VK5	3.99e-19	86.7	268	0.263	0.276	TSN5_RAT Tetraspanin-5 OS=Rattus norvegicus OX=10116 GN=Tspan5 PE=2 SV=2
13	O14817	4.73e-19	85.9	238	0.274	0.324	TSN4_HUMAN Tetraspanin-4 OS=Homo sapiens OX=9606 GN=TSPAN4 PE=1 SV=1
14	Q7ZUH9	5.19e-18	82.8	227	0.164	0.203	Q7ZUH9_DANRE Tetraspanin OS=Danio rerio OX=7955 GN=cd9l PE=2 SV=1
15	Q9DCK3	5.71e-18	82.8	238	0.263	0.311	TSN4_MOUSE Tetraspanin-4 OS=Mus musculus OX=10090 GN=Tspan4 PE=1 SV=1
16	Q9D7W4	6.26e-18	83.6	270	0.253	0.263	TSN17_MOUSE Tetraspanin-17 OS=Mus musculus OX=10090 GN=Tspan17 PE=1 SV=1
17	Q8NG11	1.29e-17	82.4	270	0.256	0.267	TSN14_HUMAN Tetraspanin-14 OS=Homo sapiens OX=9606 GN=TSPAN14 PE=1 SV=1
18	Q22495	3.11e-17	82.0	308	0.281	0.256	TSP12_CAEEL Tetraspanin-12 OS=Caenorhabditis elegans OX=6239 GN=tsp-12 PE=1 SV=1
19	Q8QZY6	4.12e-17	81.3	270	0.256	0.267	TSN14_MOUSE Tetraspanin-14 OS=Mus musculus OX=10090 GN=Tspan14 PE=1 SV=1
20	Q86UF1	4.19e-17	81.3	283	0.242	0.240	TSN33_HUMAN Tetraspanin-33 OS=Homo sapiens OX=9606 GN=TSPAN33 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03662 Glyco_hydro_79n	2.9e+02	11.8	Glycosyl hydrolase family 79, N-terminal domain
2	PF00335 Tetraspanin	9e-46	168.0	Tetraspanin family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000325708

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000302569	0.932	C-type lectin domain family 7 member A
2	9606.ENSP00000437940	0.845	B-lymphocyte antigen CD19
3	9606.ENSP00000417050	0.731	Tetraspanin
4	9606.ENSP00000085219	0.711	B-cell receptor CD22
5	9606.ENSP00000182290	0.704	Tetraspanin-32
6	9606.ENSP00000379880	0.658	Leucine-rich repeat-containing protein 3B
7	9606.ENSP00000363330	0.636	CAMPATH-1 antigen
8	9606.ENSP00000352121	0.627	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform
9	9606.ENSP00000216211	0.611	Uroplakin-3a
10	9606.ENSP00000264234	0.609	Uroplakin-1b
11	9606.ENSP00000478942	0.608	Uroplakin-1a
12	9606.ENSP00000219150	0.579	Coronin-1A
13	9606.ENSP00000294507	0.579	Lysosomal-associated transmembrane protein 5
14	9606.ENSP00000257910	0.576	Tetraspanin-31
15	9606.ENSP00000009530	0.575	HLA class II histocompatibility antigen gamma chain
16	9606.ENSP00000376544	0.563	B-cell antigen receptor complex-associated protein beta chain
17	9606.ENSP00000362456	0.556	Protein PBDC1
18	9606.ENSP00000364907	0.549	Tyrosine-protein kinase SYK
19	9606.ENSP00000428924	0.549	Tyrosine-protein kinase Lyn
20	9606.ENSP00000320084	0.531	CD276 antigen

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019899	0.468	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.989	regulation of biological process
GO:0009987	0.986	cellular process
GO:0050794	0.980	regulation of cellular process
GO:0048583	0.954	regulation of response to stimulus
GO:0050896	0.909	response to stimulus
GO:0048518	0.838	positive regulation of biological process
GO:0019222	0.731	regulation of metabolic process
GO:0032501	0.656	multicellular organismal process
GO:0002376	0.583	immune system process
GO:0001775	0.519	cell activation
GO:0002694	0.508	regulation of leukocyte activation
GO:0045321	0.476	leukocyte activation
GO:0060255	0.474	regulation of macromolecule metabolic process
GO:0048519	0.473	negative regulation of biological process
GO:0046649	0.473	lymphocyte activation
GO:0051249	0.460	regulation of lymphocyte activation
GO:0048522	0.430	positive regulation of cellular process
GO:0048523	0.421	negative regulation of cellular process
GO:0009893	0.391	positive regulation of metabolic process
GO:0010468	0.384	regulation of gene expression
GO:0010604	0.377	positive regulation of macromolecule metabolic process
GO:0002684	0.370	positive regulation of immune system process
GO:0051716	0.359	cellular response to stimulus
GO:0050776	0.357	regulation of immune response
GO:0006950	0.328	response to stress
GO:0010628	0.300	positive regulation of gene expression

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	1.000	membrane-bounded organelle
GO:0005886	1.000	plasma membrane
GO:0005576	0.993	extracellular region
GO:0031982	0.993	vesicle
GO:0070062	0.978	extracellular exosome
GO:0043229	0.768	intracellular organelle
GO:0043231	0.719	intracellular membrane-bounded organelle
GO:0001772	0.670	immunological synapse
GO:0005737	0.465	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]