StarFunc result for job id P11055

User Input

>input (1940 residues)
MSSDTEMEVFGIAAPFLRKSEKERIEAQNQPFDAKTYCFVVDSKEEYAKGKIKSSQDGKV
TVETEDNRTLVVKPEDVYAMNPPKFDRIEDMAMLTHLNEPAVLYNLKDRYTSWMIYTYSG
LFCVTVNPYKWLPVYNPEVVEGYRGKKRQEAPPHIFSISDNAYQFMLTDRENQSILITGE
SGAGKTVNTKRVIQYFATIAATGDLAKKKDSKMKGTLEDQIISANPLLEAFGNAKTVRND
NSSRFGKFIRIHFGTTGKLASADIETYLLEKSRVTFQLKAERSYHIFYQILSNKKPELIE
LLLITTNPYDYPFISQGEILVASIDDAEELLATDSAIDILGFTPEEKSGLYKLTGAVMHY
GNMKFKQKQREEQAEPDGTEVADKTAYLMGLNSSDLLKALCFPRVKVGNEYVTKGQTVDQ
VHHAVNALSKSVYEKLFLWMVTRINQQLDTKLPRQHFIGVLDIAGFEIFEYNSLEQLCIN
FTNEKLQQFFNHHMFVLEQEEYKKEGIEWTFIDFGMDLAACIELIEKPMGIFSILEEECM
FPKATDTSFKNKLYDQHLGKSNNFQKPKVVKGRAEAHFSLIHYAGTVDYSVSGWLEKNKD
PLNETVVGLYQKSSNRLLAHLYATFATADADSGKKKVAKKKGSSFQTVSALFRENLNKLM
SNLRTTHPHFVRCIIPNETKTPGAMEHSLVLHQLRCNGVLEGIRICRKGFPNRILYGDFK
QRYRVLNASAIPEGQFIDSKKACEKLLASIDIDHTQYKFGHTKVFFKAGLLGTLEEMRDD
RLAKLITRTQAVCRGFLMRVEFQKMVQRRESIFCIQYNIRSFMNVKHWPWMKLFFKIKPL
LKSAETEKEMATMKEEFQKTKDELAKSEAKRKELEEKLVTLVQEKNDLQLQVQAESENLL
DAEERCDQLIKAKFQLEAKIKEVTERAEDEEEINAELTAKKRKLEDECSELKKDIDDLEL
TLAKVEKEKHATENKVKNLTEELSGLDETIAKLTREKKALQEAHQQALDDLQAEEDKVNS
LNKTKSKLEQQVEDLESSLEQEKKLRVDLERNKRKLEGDLKLAQESILDLENDKQQLDER
LKKKDFEYCQLQSKVEDEQTLGLQFQKKIKELQARIEELEEEIEAERATRAKTEKQRSDY
ARELEELSERLEEAGGVTSTQIELNKKREAEFLKLRRDLEEATLQHEAMVAALRKKHADS
VAELGEQIDNLQRVKQKLEKEKSEFKLEIDDLSSSMESVSKSKANLEKICRTLEDQLSEA
RGKNEEIQRSLSELTTQKSRLQTEAGELSRQLEEKESIVSQLSRSKQAFTQQTEELKRQL
EEENKAKNALAHALQSSRHDCDLLREQYEEEQEGKAELQRALSKANSEVAQWRTKYETDA
IQRTEELEEAKKKLAQRLQDSEEQVEAVNAKCASLEKTKQRLQGEVEDLMVDVERANSLA
AALDKKQRNFDKVLAEWKTKCEESQAELEASLKESRSLSTELFKLKNAYEEALDQLETVK
RENKNLEQEIADLTEQIAENGKTIHELEKSRKQIELEKADIQLALEEAEAALEHEEAKIL
RIQLELTQVKSEIDRKIAEKDEEIEQLKRNYQRTVETMQSALDAEVRSRNEAIRLKKKME
GDLNEIEIQLSHANRQAAETLKHLRSVQGQLKDTQLHLDDALRGQEDLKEQLAIVERRAN
LLQAEVEELRATLEQTERARKLAEQELLDSNERVQLLHTQNTSLIHTKKKLETDLMQLQS
EVEDASRDARNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNLEQTVKDLQHRLDE
AEQLALKGGKKQIQKLETRIRELEFELEGEQKKNTESVKGLRKYERRVKELTYQSEEDRK
NVLRLQDLVDKLQVKVKSYKRQAEEADEQANAHLTKFRKAQHELEEAEERADIAESQVNK
LRAKTRDFTSSRMVVHESEE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0G2JY53	0.681	0.689	0.000	1915	0.541	0.548	A0A0G2JY53.pdb.gz	A0A0G2JY53_RAT Myosin, heavy chain 15 OS=Rattus norvegicus OX=10116 GN=Myh15 PE=3 SV=2
2	AFDB:A0A0N4STT5	0.697	0.675	0.000	2008	0.771	0.745	A0A0N4STT5.pdb.gz
3	AFDB:A7E2Y1	0.693	0.678	0.000	1983	0.671	0.657	A7E2Y1.pdb.gz	MYH7B_HUMAN Myosin-7B OS=Homo sapiens OX=9606 GN=MYH7B PE=1 SV=4
4	AFDB:B1AR69	0.667	0.668	0.000	1938	0.795	0.796	B1AR69.pdb.gz	B1AR69_MOUSE Myosin, heavy polypeptide 13, skeletal muscle OS=Mus musculus OX=10090 GN=Myh13 PE=1 SV=1
5	AFDB:B3DFS9	0.694	0.683	0.000	1974	0.401	0.394	B3DFS9.pdb.gz
6	AFDB:B8A568	0.750	0.751	0.000	1937	0.791	0.792	B8A568.pdb.gz	B8A568_DANRE Myosin, heavy polypeptide 1.1, skeletal muscle OS=Danio rerio OX=7955 GN=cb20 PE=1 SV=1
7	AFDB:B8JLS3	0.687	0.688	0.000	1936	0.750	0.752	B8JLS3.pdb.gz
8	AFDB:E7FD18	0.696	0.694	0.000	1945	0.718	0.716	E7FD18.pdb.gz
9	AFDB:F1QC64	0.640	0.707	0.000	1749	0.353	0.392	F1QC64.pdb.gz
10	AFDB:F1R3G4	0.678	0.661	0.000	1992	0.387	0.377	F1R3G4.pdb.gz	F1R3G4_DANRE Myosin, heavy chain 10, non-muscle OS=Danio rerio OX=7955 GN=myh10 PE=1 SV=1
11	PDB:4pa0A	0.339	0.655	3.483E-104	974	0.315	0.628	4pa0A.pdb.gz	Structural basis for drug-induced allosteric changes to human beta-cardiac myosin motor activity.
12	PDB:4pa0B	0.339	0.695	8.280E-100	920	0.308	0.649	4pa0B.pdb.gz	Structural basis for drug-induced allosteric changes to human beta-cardiac myosin motor activity.
13	PDB:4p7hB	0.338	0.672	9.365E-95	952	0.304	0.619	4p7hB.pdb.gz
14	PDB:5tbyA	0.371	0.721	5.853E-93	954	0.388	0.789	5tbyA.pdb.gz
15	PDB:7mf3B	0.366	0.772	3.643E-65	896	0.226	0.490	7mf3B.pdb.gz	Cryo-EM structure of the autoinhibited state of myosin-2.
16	PDB:4anjA	0.344	0.658	7.336E-60	995	0.136	0.265	4anjA.pdb.gz	Processive Steps in the Reverse Direction Require Uncoupling of the Lead Head Lever Arm of Myosin Vi.
17	PDB:6ycxB	0.362	0.820	2.617E-55	817	0.120	0.284	6ycxB.pdb.gz	Full-length Plasmodium falciparum myosin A and essential light chain PfELC structures provide new anti-malarial targets.
18	PDB:6fyxo	0.047	0.103	6.506E-2	529	0.035	0.127	6fyxo.pdb.gz	Translational initiation factor eIF5 replaces eIF1 on the 40S ribosomal subunit to promote start-codon recognition.
19	PDB:4w8fB	0.043	0.036	1.404E-1	2609	0.040	0.030	4w8fB.pdb.gz	Allosteric communication in the Dynein motor domain.
20	PDB:7wrgA	0.048	0.094	2.164E-1	812	0.024	0.057	7wrgA.pdb.gz	The architecture of kinesin-3 KLP-6 reveals a multilevel-lockdown mechanism for autoinhibition.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JY53	2088	1922	0.558	0.563	A0A0G2JY53_RAT Myosin, heavy chain 15 OS=Rattus norvegicus OX=10116 GN=Myh15 PE=3 SV=2
2	A0A0G2K0F5	3302	1912	0.839	0.851	A0A0G2K0F5_RAT Myosin heavy chain 2 OS=Rattus norvegicus OX=10116 GN=Myh2 PE=1 SV=2
3	A0A0G2K1V4	3295	1937	0.828	0.829	A0A0G2K1V4_RAT Myosin heavy chain 4 OS=Rattus norvegicus OX=10116 GN=Myh1 PE=1 SV=2
4	A0A0G2K484	3310	1939	0.835	0.835	A0A0G2K484_RAT Myosin heavy chain 4 OS=Rattus norvegicus OX=10116 GN=Myh1 PE=1 SV=2
5	A0A0R4INI3	3037	1938	0.776	0.777	A0A0R4INI3_DANRE Slow myosin heavy chain 1 OS=Danio rerio OX=7955 GN=fb18g10 PE=1 SV=1
6	A0A1D8PN92	706	1948	0.212	0.211	A0A1D8PN92_CANAL Myosin 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MYO1 PE=3 SV=1
7	A2AQP0	2523	1941	0.674	0.674	MYH7B_MOUSE Myosin-7B OS=Mus musculus OX=10090 GN=Myh7b PE=3 SV=1
8	A6QLN6	1287	1972	0.404	0.397	A6QLN6_BOVIN MYH11 protein OS=Bos taurus OX=9913 GN=MYH11 PE=1 SV=1
9	A7E2Y1	2532	1983	0.674	0.660	MYH7B_HUMAN Myosin-7B OS=Homo sapiens OX=9606 GN=MYH7B PE=1 SV=4
10	B1AR69	3159	1938	0.795	0.796	B1AR69_MOUSE Myosin, heavy polypeptide 13, skeletal muscle OS=Mus musculus OX=10090 GN=Myh13 PE=1 SV=1
11	B6IDE1	3050	1939	0.771	0.772	B6IDE1_DANRE Slow myosin heavy chain 2 OS=Danio rerio OX=7955 GN=MYH7 PE=1 SV=1
12	B6RK61	2552	1941	0.673	0.672	B6RK61_RAT Myosin heavy chain 7B OS=Rattus norvegicus OX=10116 GN=Myh7b PE=2 SV=1
13	B8A568	3110	1937	0.791	0.792	B8A568_DANRE Myosin, heavy polypeptide 1.1, skeletal muscle OS=Danio rerio OX=7955 GN=cb20 PE=1 SV=1
14	F1LMU0	3312	1939	0.832	0.833	F1LMU0_RAT Myosin heavy chain 4 OS=Rattus norvegicus OX=10116 GN=Myh4 PE=1 SV=1
15	F1LRV9	3300	1943	0.835	0.834	F1LRV9_RAT Myosin heavy chain 4 OS=Rattus norvegicus OX=10116 GN=Myh1 PE=1 SV=3
16	F1QZW1	3059	1938	0.774	0.775	F1QZW1_DANRE Myosin heavy chain 7 OS=Danio rerio OX=7955 GN=mg:cb02g011 PE=1 SV=1
17	F1R3G4	1234	1992	0.393	0.383	F1R3G4_DANRE Myosin, heavy chain 10, non-muscle OS=Danio rerio OX=7955 GN=myh10 PE=1 SV=1
18	F7F0L5	2489	1929	0.657	0.660	F7F0L5_RAT Myosin heavy chain 7B OS=Rattus norvegicus OX=10116 GN=Myh7b PE=3 SV=1
19	G3UW82	3329	1942	0.844	0.843	G3UW82_MOUSE Myosin, heavy polypeptide 2, skeletal muscle, adult OS=Mus musculus OX=10090 GN=Myh2 PE=1 SV=1
20	G3V6E1	3330	1942	0.845	0.844	G3V6E1_RAT Myosin heavy chain 2 OS=Rattus norvegicus OX=10116 GN=Myh2 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13401 AAA_22	2.7e+02	13.2	AAA domain
2	PF08647 BRE1	24	16.4	BRE1 E3 ubiquitin ligase
3	PF00612 IQ	34	15.6	IQ calmodulin-binding motif
4	PF00063 Myosin_head	5.9e-283	951.9	Myosin head (motor domain)
5	PF02736 Myosin_N	9.9e-10	49.3	Myosin N-terminal SH3-like domain
6	PF01576 Myosin_tail_1	4.3e-154	526.7	Myosin tail

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000464317

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000443495	0.977	Alpha-actinin-2
2	9606.ENSP00000307280	0.975	Myosin light chain 1/3, skeletal muscle isoform
3	9606.ENSP00000354488	0.975	Troponin I, slow skeletal muscle
4	9606.ENSP00000367542	0.961	Tropomyosin beta chain
5	9606.ENSP00000450385	0.961	Myosin light chain 6B
6	9606.ENSP00000279022	0.951	Myosin regulatory light polypeptide 9
7	9606.ENSP00000325239	0.945	Myosin light chain, phosphorylatable, fast skeletal muscle
8	9606.ENSP00000383023	0.944	Myosin light chain 5
9	9606.ENSP00000379210	0.939	Myosin light chain 3
10	9606.ENSP00000386041	0.932	Myosin-6
11	9606.ENSP00000347055	0.919	Myosin light chain 4
12	9606.ENSP00000384330	0.919	Myosin-8
13	9606.ENSP00000278317	0.917	Troponin T, fast skeletal muscle
14	9606.ENSP00000228841	0.913	Myosin regulatory light chain 2, ventricular/cardiac muscle isoform
15	9606.ENSP00000463559	0.891	Myosin regulatory light chain 12B
16	9606.ENSP00000371331	0.890	Troponin I, fast skeletal muscle
17	9606.ENSP00000467141	0.886	Titin
18	9606.ENSP00000236918	0.867	Troponin T, cardiac muscle
19	9606.ENSP00000361636	0.860	Troponin C, skeletal muscle
20	9606.ENSP00000217652	0.849	Myosin regulatory light chain 12A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003674	1.000	molecular_function
GO:0005515	0.992	protein binding
GO:0000146	0.992	microfilament motor activity
GO:0008092	0.928	cytoskeletal protein binding
GO:0004721	0.862	phosphoprotein phosphatase activity
GO:0004722	0.847	protein serine/threonine phosphatase activity
GO:0003779	0.828	actin binding
GO:0044877	0.817	protein-containing complex binding
GO:0051015	0.686	actin filament binding
GO:0097159	0.671	organic cyclic compound binding
GO:1901363	0.669	heterocyclic compound binding
GO:0042802	0.497	identical protein binding
GO:0016887	0.487	ATP hydrolysis activity
GO:0017018	0.465	myosin phosphatase activity
GO:0043167	0.411	ion binding
GO:0043168	0.358	anion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032501	0.995	multicellular organismal process
GO:0009987	0.989	cellular process
GO:0003012	0.973	muscle system process
GO:0032502	0.955	developmental process
GO:0048856	0.939	anatomical structure development
GO:0006936	0.916	muscle contraction
GO:0030029	0.891	actin filament-based process
GO:0006941	0.857	striated muscle contraction
GO:0065007	0.787	biological regulation
GO:0061061	0.784	muscle structure development
GO:0050789	0.691	regulation of biological process
GO:0050896	0.534	response to stimulus
GO:0071840	0.460	cellular component organization or biogenesis
GO:0050877	0.447	nervous system process
GO:0016043	0.421	cellular component organization
GO:0007275	0.327	multicellular organism development
GO:0050879	0.321	multicellular organismal movement
GO:0048513	0.315	animal organ development
GO:0050794	0.314	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043292	0.996	contractile fiber
GO:0032991	0.987	protein-containing complex
GO:0005856	0.969	cytoskeleton
GO:0005829	0.940	cytosol
GO:0015629	0.884	actin cytoskeleton
GO:0030016	0.834	myofibril
GO:0043227	0.780	membrane-bounded organelle
GO:0016459	0.560	myosin complex
GO:0016460	0.531	myosin II complex
GO:0043231	0.525	intracellular membrane-bounded organelle
GO:0030017	0.416	sarcomere
GO:0070062	0.408	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:5.6.1.8	0.992	myosin ATPase.
EC:3.1.3.-	0.862	Phosphoric monoester hydrolases.
EC:3.1.3.16	0.847	protein-serine/threonine phosphatase.
RHEA:13065	0.487	ATP + H2O = ADP + H(+) + phosphate

[back to server]