StarFunc result for job id P11086

User Input

>input (282 residues)
MSGADRSPNAGAAPDSAPGQAAVASAYQRFEPRAYLRNNYAPPRGDLCNPNGVGPWKLRC
LAQTFATGEVSGRTLIDIGSGPTVYQLLSACSHFEDITMTDFLEVNRQELGRWLQEEPGA
FNWSMYSQHACLIEGKGECWQDKERQLRARVKRVLPIDVHQPQPLGAGSPAPLPADALVS
AFCLEAVSPDLASFQRALDHITTLLRPGGHLLLIGALEESWYLAGEARLTVVPVSEEEVR
EALVRSGYKVRDLRTYIMPAHLQTGVDDVKGVFFAWAQKVGL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A5F8AH41	0.959	0.959	1.578E-58	282	0.954	0.954	A0A5F8AH41.pdb.gz	PNMT_MACMU Phenylethanolamine N-methyltransferase OS=Macaca mulatta OX=9544 GN=PNMT PE=1 SV=1
2	AFDB:P40935	0.955	0.914	8.488E-56	295	0.844	0.807	P40935.pdb.gz	PNMT_MOUSE Phenylethanolamine N-methyltransferase OS=Mus musculus OX=10090 GN=Pnmt PE=1 SV=1
3	PDB:2an3B	0.950	0.995	5.602E-55	269	0.954	1.000	2an3B.pdb.gz	Mode of binding of methyl acceptor substrates to the adrenaline-synthesizing enzyme phenylethanolamine N-methyltransferase: implications for catalysis
4	AFDB:P10938	0.945	0.942	3.357E-54	283	0.840	0.837	P10938.pdb.gz	PNMT_BOVIN Phenylethanolamine N-methyltransferase OS=Bos taurus OX=9913 GN=PNMT PE=1 SV=2
5	AFDB:P40261	0.844	0.899	2.241E-31	264	0.355	0.379	P40261.pdb.gz	NNMT_HUMAN Nicotinamide N-methyltransferase OS=Homo sapiens OX=9606 GN=NNMT PE=1 SV=1
6	AFDB:D4A605	0.835	0.890	2.677E-31	264	0.344	0.367	D4A605.pdb.gz	D4A605_RAT Nicotinamide N-methyltransferase OS=Rattus norvegicus OX=10116 GN=Nnmt PE=3 SV=1
7	PDB:2i62B	0.847	0.912	1.989E-30	261	0.362	0.391	2i62B.pdb.gz	The Crystal Structure of Mouse Nicotinamide N-methyltransferase in complex with SAH
8	AFDB:P40936	0.847	0.903	3.640E-30	264	0.337	0.360	P40936.pdb.gz	INMT_MOUSE Indolethylamine N-methyltransferase OS=Mus musculus OX=10090 GN=Inmt PE=1 SV=1
9	PDB:6orrC	0.839	0.866	4.054E-30	273	0.344	0.355	6orrC.pdb.gz	High-Affinity Alkynyl Bisubstrate Inhibitors of NicotinamideN-Methyltransferase (NNMT).
10	PDB:2a14A	0.836	0.915	1.047E-29	257	0.340	0.374	2a14A.pdb.gz	The Crystal Structure of Human Indolethylamine N-methyltransferase in complex with SAH.
11	AFDB:O95050	0.844	0.903	1.192E-29	263	0.333	0.357	O95050.pdb.gz	INMT_HUMAN Indolethylamine N-methyltransferase OS=Homo sapiens OX=9606 GN=INMT PE=1 SV=3
12	AFDB:P34254	0.755	0.779	3.080E-18	273	0.213	0.220	P34254.pdb.gz	NNMT1_CAEEL Nicotinamide N-methyltransferase OS=Caenorhabditis elegans OX=6239 GN=anmt-1 PE=3 SV=1
13	AFDB:O74386	0.466	0.520	1.948E-11	248	0.156	0.177	O74386.pdb.gz	TR141_SCHPO tRNA N(3)-methylcytidine methyltransferase trm141 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=trm141 PE=1 SV=1
14	AFDB:Q6NN40	0.572	0.583	5.339E-11	276	0.110	0.112	Q6NN40.pdb.gz	NTM1_DROME Alpha N-terminal protein methyltransferase 1 OS=Drosophila melanogaster OX=7227 GN=Ntmt PE=1 SV=1
15	PDB:7ezgA	0.451	0.461	9.103E-10	275	0.106	0.109	7ezgA.pdb.gz	Crystal structure of human METTL6, the m 3 C methyltransferase.
16	PDB:7d8fA	0.489	0.574	6.446E-9	234	0.103	0.124	7d8fA.pdb.gz	Structural Basis for Peptide Binding of Alpha-N Terminal Methyltransferase from Saccharomyces cerevisiae
17	PDB:4hh4C	0.501	0.544	1.167E-8	256	0.096	0.105	4hh4C.pdb.gz	Structure and possible mechanism of the CcbJ methyltransferase from Streptomyces caelestis.
18	PDB:6dtnB	0.495	0.583	1.990E-8	233	0.138	0.167	6dtnB.pdb.gz	Discovery of Bisubstrate Inhibitors for Protein N-Terminal Methyltransferase 1.
19	PDB:3lccA	0.427	0.539	2.377E-8	216	0.131	0.171	3lccA.pdb.gz	Halomethane Biosynthesis: Structure of a SAM-Dependent Halide Methyltransferase from Arabidopsis thaliana
20	PDB:1nbhA	0.495	0.480	3.014E-8	292	0.149	0.144	1nbhA.pdb.gz	Catalytic mechanism of glycine N-methyltransferase

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A5F8AH41	0.0	555	282	0.954	0.954	PNMT_MACMU Phenylethanolamine N-methyltransferase OS=Macaca mulatta OX=9544 GN=PNMT PE=1 SV=1
2	P11086	0.0	581	282	1.000	1.000	PNMT_HUMAN Phenylethanolamine N-methyltransferase OS=Homo sapiens OX=9606 GN=PNMT PE=1 SV=1
3	P40935	6.96e-177	491	295	0.844	0.807	PNMT_MOUSE Phenylethanolamine N-methyltransferase OS=Mus musculus OX=10090 GN=Pnmt PE=1 SV=1
4	P10937	1.09e-175	488	285	0.833	0.825	PNMT_RAT Phenylethanolamine N-methyltransferase OS=Rattus norvegicus OX=10116 GN=Pnmt PE=1 SV=3
5	P10938	3.65e-173	481	283	0.840	0.837	PNMT_BOVIN Phenylethanolamine N-methyltransferase OS=Bos taurus OX=9913 GN=PNMT PE=1 SV=2
6	O55239	2.30e-57	186	264	0.355	0.379	NNMT_MOUSE Nicotinamide N-methyltransferase OS=Mus musculus OX=10090 GN=Nnmt PE=1 SV=1
7	D4A605	7.52e-56	182	264	0.344	0.367	D4A605_RAT Nicotinamide N-methyltransferase OS=Rattus norvegicus OX=10116 GN=Nnmt PE=3 SV=1
8	O95050	2.37e-55	181	263	0.340	0.365	INMT_HUMAN Indolethylamine N-methyltransferase OS=Homo sapiens OX=9606 GN=INMT PE=1 SV=3
9	P40261	7.22e-54	177	264	0.351	0.375	NNMT_HUMAN Nicotinamide N-methyltransferase OS=Homo sapiens OX=9606 GN=NNMT PE=1 SV=1
10	P40936	1.46e-52	174	264	0.333	0.356	INMT_MOUSE Indolethylamine N-methyltransferase OS=Mus musculus OX=10090 GN=Inmt PE=1 SV=1
11	A0A8I6A6E7	7.50e-25	99.4	156	0.191	0.346	A0A8I6A6E7_RAT Nicotinamide N-methyltransferase OS=Rattus norvegicus OX=10116 GN=Nnmt PE=1 SV=1
12	P34254	1.07e-14	74.3	273	0.227	0.234	NNMT1_CAEEL Nicotinamide N-methyltransferase OS=Caenorhabditis elegans OX=6239 GN=anmt-1 PE=3 SV=1
13	Q9NYC9	0.042	38.1	4486	0.113	0.007	DYH9_HUMAN Dynein axonemal heavy chain 9 OS=Homo sapiens OX=9606 GN=DNAH9 PE=1 SV=3
14	Q9P7L6	0.048	37.0	307	0.057	0.052	TR140_SCHPO tRNA N(3)-methylcytidine methyltransferase trm140 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=trm140 PE=1 SV=2
15	F7DC70	0.055	37.4	1958	0.117	0.017	F7DC70_MOUSE Dynein, axonemal, heavy chain 9 (Fragment) OS=Mus musculus OX=10090 GN=Dnah9 PE=1 SV=1
16	B1AR51	0.078	37.0	4484	0.117	0.007	B1AR51_MOUSE Dynein, axonemal, heavy chain 9 OS=Mus musculus OX=10090 GN=Dnah9 PE=1 SV=1
17	Q08641	0.097	36.6	628	0.089	0.040	AB140_YEAST tRNA(Thr) (cytosine(32)-N(3))-methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ABP140 PE=1 SV=3
18	A5HEI1	0.21	35.8	1846	0.092	0.014	SCC2_ARATH Sister chromatid cohesion protein SCC2 OS=Arabidopsis thaliana OX=3702 GN=SCC2 PE=1 SV=1
19	Q96IZ6	0.24	35.0	378	0.060	0.045	MET2A_HUMAN tRNA N(3)-methylcytidine methyltransferase METTL2A OS=Homo sapiens OX=9606 GN=METTL2A PE=1 SV=5
20	Q6P1Q9	0.27	35.0	378	0.064	0.048	MET2B_HUMAN tRNA N(3)-methylcytidine methyltransferase METTL2B OS=Homo sapiens OX=9606 GN=METTL2B PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08241 Methyltransf_11	1.5e+02	14.4	Methyltransferase domain
2	PF08242 Methyltransf_12	1.4e+02	14.6	Methyltransferase domain
3	PF13489 Methyltransf_23	21	16.4	Methyltransferase domain
4	PF13649 Methyltransf_25	6.1e+02	12.5	Methyltransferase domain
5	PF01234 NNMT_PNMT_TEMT	3.8e-96	332.8	NNMT/PNMT/TEMT family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000269582

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000376776	0.989	Dopamine beta-hydroxylase
2	9606.ENSP00000354511	0.963	Catechol O-methyltransferase
3	9606.ENSP00000340684	0.940	Amine oxidase [flavin-containing] A
4	9606.ENSP00000367309	0.939	Amine oxidase [flavin-containing] B
5	9606.ENSP00000305742	0.906	Transmembrane O-methyltransferase
6	9606.ENSP00000370571	0.897	Tyrosine 3-monooxygenase
7	9606.ENSP00000403644	0.739	Aromatic-L-amino-acid decarboxylase
8	9606.ENSP00000448059	0.683	Catalyzes the hydroxylation of L-phenylalanine to L-tyrosine.
9	9606.ENSP00000370639	0.662	Acetylserotonin O-methyltransferase
10	9606.ENSP00000411613	0.641	Amiloride-sensitive amine oxidase [copper-containing]
11	9606.ENSP00000384364	0.630	Pro-neuropeptide Y
12	9606.ENSP00000282091	0.626	Parathyroid hormone
13	9606.ENSP00000329357	0.615	Transcription factor Sp1
14	9606.ENSP00000384092	0.556	Pro-opiomelanocortin
15	9606.ENSP00000250018	0.548	Belongs to the biopterin-dependent aromatic amino acid hydroxylase family
16	9606.ENSP00000324248	0.546	Proenkephalin-A
17	9606.ENSP00000312624	0.542	Telethonin
18	9606.ENSP00000365931	0.539	Transcription factor Sp2
19	9606.ENSP00000276571	0.537	Corticoliberin
20	9606.ENSP00000219833	0.517	Sodium-dependent noradrenaline transporter

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008757	1.000	S-adenosylmethionine-dependent methyltransferase activity
GO:0008170	1.000	N-methyltransferase activity
GO:0004603	0.972	phenylethanolamine N-methyltransferase activity
GO:0005515	0.924	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009308	0.994	amine metabolic process
GO:0009987	0.986	cellular process
GO:0044237	0.979	cellular metabolic process
GO:1901615	0.955	organic hydroxy compound metabolic process
GO:0034641	0.955	cellular nitrogen compound metabolic process
GO:0044271	0.952	cellular nitrogen compound biosynthetic process
GO:0042401	0.920	biogenic amine biosynthetic process
GO:1901360	0.908	organic cyclic compound metabolic process
GO:0006584	0.876	catecholamine metabolic process
GO:0042423	0.828	catecholamine biosynthetic process
GO:0050896	0.365	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.995	cytosol
GO:0043231	0.446	intracellular membrane-bounded organelle
GO:0016020	0.370	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.1.1.-	1.000	Methyltransferases.
RHEA:12176	0.972	phenylethanolamine + S-adenosyl-L-methionine = H(+) + N-methylphenylethanolamine + S-adenosyl-L-homocysteine
EC:2.1.1.28	0.972	phenylethanolamine N-methyltransferase.

[back to server]