StarFunc result for job id P11137

User Input

>input (1827 residues)
MADERKDEAKAPHWTSAPLTEASAHSHPPEIKDQGGAGEGLVRSANGFPYREDEEGAFGE
HGSQGTYSNTKENGINGELTSADRETAEEVSARIVQVVTAEAVAVLKGEQEKEAQHKDQT
AALPLAAEETANLPPSPPPSPASEQTVTVEEDLLTASKMEFHDQQELTPSTAEPSDQKEK
ESEKQSKPGEDLKHAALVSQPETTKTYPDKKDMQGTEEEKAPLALFGHTLVASLEDMKQK
TEPSLVVPGIDLPKEPPTPKEQKDWFIEMPTEAKKDEWGLVAPISPGPLTPMREKDVFDD
IPKWEGKQFDSPMPSPFQGGSFTLPLDVMKNEIVTETSPFAPAFLQPDDKKSLQQTSGPA
TAKDSFKIEEPHEAKPDKMAEAPPSEAMTLPKDAHIPVVEEHVMGKVLEEEKEAINQETV
QQRDTFTPSGQEPILTEKETELKLEEKTTISDKEAVPKESKPPKPADEEIGIIQTSTEHT
FSEQKDQEPTTDMLKQDSFPVSLEQAVTDSAMTSKTLEKAMTEPSALIEKSSIQELFEMR
VDDKDKIEGVGAATSAELDMPFYEDKSGMSKYFETSALKEEATKSIEPGSDYYELSDTRE
SVHESIDTMSPMHKNGDKEFQTGKESQPSPPAQEAGYSTLAQSYPSDLPEEPSSPQERMF
TIDPKVYGEKRDLHSKNKDDLTLSRSLGLGGRSAIEQRSMSINLPMSCLDSIALGFNFGR
GHDLSPLASDILTNTSGSMDEGDDYLPATTPALEKAPCFPVESKEEEQIEKVKATGEEST
QAEISCESPFLAKDFYKNGTVMAPDLPEMLDLAGTRSRLASVSADAEVARRKSVPSETVV
EDSRTGLPPVTDENHVIVKTDSQLEDLGYCVFNKYTVPLPSPVQDSENLSGESGTFYEGT
DDKVRRDLATDLSLIEVKLAAAGRVKDEFSVDKEASAHISGDKSGLSKEFDQEKKANDRL
DTVLEKSEEHADSKEHAKKTEEAGDEIETFGLGVTYEQALAKDLSIPTDASSEKAEKGLS
SVPEIAEVEPSKKVEQGLDFAVQGQLDVKISDFGQMASGLNIDDRRATELKLEATQDMTP
SSKAPQEADAFMGVESGHMKEGTKVSETEVKEKVAKPDLVHQEAVDKEESYESSGEHESL
TMESLKADEGKKETSPESSLIQDEIAVKLSVEIPCPPAVSEADLATDERADVQMEFIQGP
KEESKETPDISITPSDVAEPLHETIVSEPAEIQSEEEEIEAQGEYDKLLFRSDTLQITDL
GVSGAREEFVETCPSEHKGVIESVVTIEDDFITVVQTTTDEGESGSHSVRFAALEQPEVE
RRPSPHDEEEFEVEEAAEAQAEPKDGSPEAPASPEREEVALSEYKTETYDDYKDETTIDD
SIMDADSLWVDTQDDDRSIMTEQLETIPKEEKAEKEARRSSLEKHRKEKPFKTGRGRIST
PERKVAKKEPSTVSRDEVRRKKAVYKKAELAKKTEVQAHSPSRKFILKPAIKYTRPTHLS
CVKRKTTAAGGESALAPSVFKQAKDKVSDGVTKSPEKRSSLPRPSSILPPRRGVSGDRDE
NSFSLNSSISSSARRTTRSEPIRRAGKSGTSTPTTPGSTAITPGTPPSYSSRTPGTPGTP
SYPRTPHTPGTPKSAILVPSEKKVAIIRTPPKSPATPKQLRLINQPLPDLKNVKSKIGST
DNIKYQPKGGQVQIVTKKIDLSHVTSKCGSLKNIRHRPGGGRVKIESVKLDFKEKAQAKV
GSLDNAHHVPGGGNVKIDSQKLNFREHAKARVDHGAEIITQSPGRSSVASPRRLSNVSSS
GSINLLESPQLATLAEDVTAALAKQGL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P11137	1.000	1.000	0.000	1827	1.000	1.000	P11137.pdb.gz	MTAP2_HUMAN Microtubule-associated protein 2 OS=Homo sapiens OX=9606 GN=MAP2 PE=1 SV=4
2	AFDB:P15146	0.128	0.127	0.000	1861	0.802	0.787	P15146.pdb.gz	MTAP2_RAT Microtubule-associated protein 2 OS=Rattus norvegicus OX=10116 GN=Map2 PE=1 SV=3
3	AFDB:P20357	0.191	0.191	0.000	1828	0.806	0.806	P20357.pdb.gz	MTAP2_MOUSE Microtubule-associated protein 2 OS=Mus musculus OX=10090 GN=Map2 PE=1 SV=2
4	AFDB:P19332	0.044	0.087	5.995E-15	752	0.131	0.318	P19332.pdb.gz	TAU_RAT Microtubule-associated protein tau OS=Rattus norvegicus OX=10116 GN=Mapt PE=1 SV=3
5	AFDB:A0A024R9Y1	0.029	0.049	6.827E-13	758	0.115	0.278	A0A024R9Y1.pdb.gz
6	AFDB:P27816	0.028	0.040	1.536E-7	1152	0.129	0.205	P27816.pdb.gz	MAP4_HUMAN Microtubule-associated protein 4 OS=Homo sapiens OX=9606 GN=MAP4 PE=1 SV=3
7	AFDB:P27546	0.031	0.047	1.749E-7	1125	0.124	0.202	P27546.pdb.gz	MAP4_MOUSE Microtubule-associated protein 4 OS=Mus musculus OX=10090 GN=Map4 PE=1 SV=3
8	AFDB:Q9QX47	0.028	0.024	2.342E-4	2444	0.178	0.133	Q9QX47.pdb.gz	SON_MOUSE Protein SON OS=Mus musculus OX=10090 GN=Son PE=1 SV=2
9	AFDB:Q9EPQ8	0.040	0.039	1.867E-3	1987	0.152	0.140	Q9EPQ8.pdb.gz	TCF20_MOUSE Transcription factor 20 OS=Mus musculus OX=10090 GN=Tcf20 PE=1 SV=3
10	AFDB:M9NGY4	0.034	0.034	1.992E-3	1885	0.116	0.112	M9NGY4.pdb.gz	M9NGY4_DROME ZAP3, isoform E OS=Drosophila melanogaster OX=7227 GN=ZAP3 PE=1 SV=1
11	PDB:3bw1A	0.010	0.202	6.551	86	0.001	0.012	3bw1A.pdb.gz
12	PDB:5ondA	0.011	0.118	6.990	135	0.002	0.022	5ondA.pdb.gz	The universally-conserved transcription factor RfaH is recruited to a hairpin structure of the non-template DNA strand.
13	PDB:7mq8SQ	0.018	0.120	7.459	187	0.010	0.102	7mq8SQ.pdb.gz	Nucleolar maturation of the human small subunit processome.
14	PDB:4mqwB	0.019	0.175	7.958	109	0.003	0.046	4mqwB.pdb.gz
15	PDB:7rroD	0.017	0.123	8.492	147	0.010	0.129	7rroD.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
16	PDB:3k8aB	0.010	0.156	9.061	103	0.002	0.029	3k8aB.pdb.gz
17	PDB:6eu0M	0.016	0.102	9.668	197	0.006	0.056	6eu0M.pdb.gz	Structural basis of RNA polymerase III transcription initiation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1MEW3	0.0	2726	2008	0.800	0.728	F1MEW3_BOVIN Microtubule-associated protein OS=Bos taurus OX=9913 GN=MAP2 PE=4 SV=2
2	P11137	0.0	3690	1827	1.000	1.000	MTAP2_HUMAN Microtubule-associated protein 2 OS=Homo sapiens OX=9606 GN=MAP2 PE=1 SV=4
3	P15146	0.0	2775	1861	0.801	0.787	MTAP2_RAT Microtubule-associated protein 2 OS=Rattus norvegicus OX=10116 GN=Map2 PE=1 SV=3
4	P20357	0.0	2798	1828	0.804	0.803	MTAP2_MOUSE Microtubule-associated protein 2 OS=Mus musculus OX=10090 GN=Map2 PE=1 SV=2
5	P29172	8.78e-74	256	448	0.076	0.310	TAU_BOVIN Microtubule-associated protein tau OS=Bos taurus OX=9913 GN=MAPT PE=1 SV=3
6	P19332	6.13e-72	259	752	0.082	0.198	TAU_RAT Microtubule-associated protein tau OS=Rattus norvegicus OX=10116 GN=Mapt PE=1 SV=3
7	P10637	4.65e-71	256	733	0.081	0.202	TAU_MOUSE Microtubule-associated protein tau OS=Mus musculus OX=10090 GN=Mapt PE=1 SV=3
8	P10636	9.91e-71	256	758	0.077	0.185	TAU_HUMAN Microtubule-associated protein tau OS=Homo sapiens OX=9606 GN=MAPT PE=1 SV=5
9	Q5M7W5	3.77e-33	142	1057	0.034	0.060	MAP4_RAT Microtubule-associated protein 4 OS=Rattus norvegicus OX=10116 GN=Map4 PE=1 SV=1
10	P27546	5.46e-29	129	1125	0.032	0.052	MAP4_MOUSE Microtubule-associated protein 4 OS=Mus musculus OX=10090 GN=Map4 PE=1 SV=3
11	P27816	6.91e-29	129	1152	0.032	0.050	MAP4_HUMAN Microtubule-associated protein 4 OS=Homo sapiens OX=9606 GN=MAP4 PE=1 SV=3
12	A0A0B4KI45	2.39e-22	102	308	0.043	0.253	A0A0B4KI45_DROME Microtubule-associated protein OS=Drosophila melanogaster OX=7227 GN=tau PE=1 SV=1
13	A0A0B4LHV0	7.23e-21	97.1	278	0.039	0.259	A0A0B4LHV0_DROME Microtubule-associated protein OS=Drosophila melanogaster OX=7227 GN=tau PE=1 SV=1
14	A0A0B4LHS3	1.37e-20	97.8	350	0.043	0.226	A0A0B4LHS3_DROME Microtubule-associated protein OS=Drosophila melanogaster OX=7227 GN=tau PE=1 SV=1
15	A0A0B4LIT4	1.52e-20	97.8	367	0.039	0.196	A0A0B4LIT4_DROME Microtubule-associated protein OS=Drosophila melanogaster OX=7227 GN=tau PE=1 SV=1
16	A0A0B4KHQ8	1.59e-20	97.4	349	0.039	0.206	A0A0B4KHQ8_DROME Microtubule-associated protein OS=Drosophila melanogaster OX=7227 GN=tau PE=1 SV=1
17	Q9VB13	1.62e-20	97.8	361	0.039	0.199	Q9VB13_DROME Microtubule-associated protein OS=Drosophila melanogaster OX=7227 GN=tau PE=1 SV=2
18	A0A126GV16	1.87e-20	97.8	375	0.039	0.192	A0A126GV16_DROME Microtubule-associated protein OS=Drosophila melanogaster OX=7227 GN=tau PE=1 SV=1
19	A0A0B4LIS6	3.64e-20	97.4	403	0.039	0.179	A0A0B4LIS6_DROME Microtubule-associated protein OS=Drosophila melanogaster OX=7227 GN=tau PE=1 SV=1
20	Q9VB15	2.41e-19	97.1	717	0.040	0.102	Q9VB15_DROME Microtubule-associated protein OS=Drosophila melanogaster OX=7227 GN=tau PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08377 MAP2_projctn	0	2300.5	MAP2/Tau projection domain
2	PF10522 RII_binding_1	5.1	18.5	RII binding domain
3	PF00418 Tubulin-binding	9.2e-43	155.2	Tau and MAP protein, tubulin-binding repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000353508

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000385751	0.945	Serine/threonine-protein kinase MARK2
2	9606.ENSP00000265717	0.934	cAMP-dependent protein kinase type II-beta regulatory subunit
3	9606.ENSP00000371614	0.915	Serine/threonine-protein kinase BRSK2
4	9606.ENSP00000310649	0.912	Serine/threonine-protein kinase BRSK1
5	9606.ENSP00000376345	0.898	Growth factor receptor-bound protein 2
6	9606.ENSP00000468500	0.889	Glial fibrillary acidic protein
7	9606.ENSP00000265563	0.863	cAMP-dependent protein kinase type II-alpha regulatory subunit
8	9606.ENSP00000263233	0.848	Synaptophysin
9	9606.ENSP00000346671	0.836	Tyrosine-protein kinase Fyn
10	9606.ENSP00000357206	0.834	Nestin
11	9606.ENSP00000296755	0.832	Microtubule-associated protein 1B
12	9606.ENSP00000482169	0.824	Neurofilament light polypeptide
13	9606.ENSP00000463653	0.818	RNA binding protein fox-1 homolog 3
14	9606.ENSP00000291700	0.806	Protein S100-B
15	9606.ENSP00000451560	0.804	Uncharacterized protein
16	9606.ENSP00000377372	0.801	Neuromodulin
17	9606.ENSP00000295987	0.797	Synapsin-1
18	9606.ENSP00000320295	0.792	Tubulin beta-3 chain
19	9606.ENSP00000349960	0.785	Actin, cytoplasmic 1
20	9606.ENSP00000337697	0.757	Neuronal migration protein doublecortin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008017	1.000	microtubule binding
GO:0019899	0.891	enzyme binding
GO:0002162	0.655	dystroglycan binding
GO:0019901	0.545	protein kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0009987	0.991	cellular process
GO:0048523	0.985	negative regulation of cellular process
GO:0048856	0.967	anatomical structure development
GO:0065008	0.954	regulation of biological quality
GO:0050896	0.946	response to stimulus
GO:0032886	0.943	regulation of microtubule-based process
GO:0032501	0.937	multicellular organismal process
GO:0050793	0.936	regulation of developmental process
GO:0007275	0.926	multicellular organism development
GO:0051128	0.925	regulation of cellular component organization
GO:0048869	0.916	cellular developmental process
GO:0048731	0.901	system development
GO:0016043	0.876	cellular component organization
GO:0007399	0.866	nervous system development
GO:0033043	0.828	regulation of organelle organization
GO:0030154	0.809	cell differentiation
GO:1902903	0.755	regulation of supramolecular fiber organization
GO:0051493	0.743	regulation of cytoskeleton organization
GO:0070507	0.730	regulation of microtubule cytoskeleton organization
GO:0051093	0.714	negative regulation of developmental process
GO:0010721	0.677	negative regulation of cell development
GO:0032879	0.670	regulation of localization
GO:0009653	0.649	anatomical structure morphogenesis
GO:0042221	0.635	response to chemical
GO:0051239	0.519	regulation of multicellular organismal process
GO:0030030	0.515	cell projection organization
GO:0048468	0.497	cell development
GO:0022008	0.485	neurogenesis
GO:0048518	0.483	positive regulation of biological process
GO:0048699	0.481	generation of neurons
GO:0044087	0.463	regulation of cellular component biogenesis
GO:0031175	0.461	neuron projection development
GO:0060341	0.457	regulation of cellular localization
GO:0048522	0.445	positive regulation of cellular process
GO:0022603	0.436	regulation of anatomical structure morphogenesis
GO:0051716	0.425	cellular response to stimulus
GO:0030516	0.425	regulation of axon extension
GO:0050770	0.418	regulation of axonogenesis
GO:0031345	0.416	negative regulation of cell projection organization
GO:0031110	0.408	regulation of microtubule polymerization or depolymerization
GO:0050771	0.392	negative regulation of axonogenesis
GO:0000902	0.383	cell morphogenesis
GO:0043254	0.380	regulation of protein-containing complex assembly
GO:0032271	0.366	regulation of protein polymerization
GO:0048858	0.365	cell projection morphogenesis
GO:0031113	0.363	regulation of microtubule polymerization
GO:0120039	0.353	plasma membrane bounded cell projection morphogenesis
GO:0016358	0.339	dendrite development
GO:0010033	0.334	response to organic substance
GO:0019222	0.331	regulation of metabolic process
GO:0032880	0.305	regulation of protein localization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.998	cytoplasm
GO:0005856	0.998	cytoskeleton
GO:0032991	0.997	protein-containing complex
GO:0015630	0.994	microtubule cytoskeleton
GO:0005829	0.991	cytosol
GO:0005634	0.988	nucleus
GO:0016020	0.961	membrane
GO:0071944	0.945	cell periphery
GO:0031974	0.941	membrane-enclosed lumen
GO:0070013	0.934	intracellular organelle lumen
GO:0005886	0.927	plasma membrane
GO:0012505	0.925	endomembrane system
GO:0005875	0.894	microtubule associated complex
GO:0120025	0.877	plasma membrane bounded cell projection
GO:0030054	0.798	cell junction
GO:0031981	0.706	nuclear lumen
GO:0036477	0.681	somatodendritic compartment
GO:0030425	0.666	dendrite
GO:0030424	0.661	axon
GO:0045202	0.523	synapse
GO:0098794	0.478	postsynapse
GO:0005654	0.416	nucleoplasm
GO:0044297	0.394	cell body
GO:0043025	0.364	neuronal cell body

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]