StarFunc result for job id P11161

User Input

>input (476 residues)
MMTAKAVDKIPVTLSGFVHQLSDNIYPVEDLAATSVTIFPNAELGGPFDQMNGVAGDGMI
NIDMTGEKRSLDLPYPSSFAPVSAPRNQTFTYMGKFSIDPQYPGASCYPEGIINIVSAGI
LQGVTSPASTTASSSVTSASPNPLATGPLGVCTMSQTQPDLDHLYSPPPPPPPYSGCAGD
LYQDPSAFLSAATTSTSSSLAYPPPPSYPSPKPATDPGLFPMIPDYPGFFPSQCQRDLHG
TAGPDRKPFPCPLDTLRVPPPLTPLSTIRNFTLGGPSAGVTGPGASGGSEGPRLPGSSSA
AAAAAAAAAYNPHHLPLRPILRPRKYPNRPSKTPVHERPYPCPAEGCDRRFSRSDELTRH
IRIHTGHKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDYCGRKFARSDERKRHTKIH
LRQKERKSSAPSASVPAPSTASCSGGVQPGGTLCSSNSSSLGGGPLAPCSSRTRTP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P11161	1.000	1.000	4.079E-69	476	1.000	1.000	P11161.pdb.gz	EGR2_HUMAN E3 SUMO-protein ligase EGR2 OS=Homo sapiens OX=9606 GN=EGR2 PE=1 SV=3
2	AFDB:P08152	0.354	0.358	1.480E-58	470	0.889	0.900	P08152.pdb.gz	EGR2_MOUSE E3 SUMO-protein ligase EGR2 OS=Mus musculus OX=10090 GN=Egr2 PE=1 SV=3
3	AFDB:P18146	0.208	0.184	1.346E-21	543	0.395	0.346	P18146.pdb.gz	EGR1_HUMAN Early growth response protein 1 OS=Homo sapiens OX=9606 GN=EGR1 PE=1 SV=1
4	AFDB:Q9VED3	0.201	0.081	1.196E-13	1186	0.340	0.137	Q9VED3.pdb.gz	Q9VED3_DROME Stripe, isoform A OS=Drosophila melanogaster OX=7227 GN=sr PE=4 SV=1
5	AFDB:R9PY21	0.187	0.124	1.240E-12	720	0.233	0.154	R9PY21.pdb.gz	R9PY21_DROME Sp1, isoform E OS=Drosophila melanogaster OX=7227 GN=Sp1 PE=4 SV=1
6	AFDB:Q5BIH1	0.178	0.109	8.601E-12	803	0.254	0.151	Q5BIH1.pdb.gz	Q5BIH1_DROME RE58581p OS=Drosophila melanogaster OX=7227 GN=klu PE=2 SV=1
7	AFDB:A0A0A0MT54	0.182	0.167	4.274E-11	522	0.250	0.228	A0A0A0MT54.pdb.gz	A0A0A0MT54_HUMAN Wilms tumor protein OS=Homo sapiens OX=9606 GN=WT1 PE=1 SV=2
8	AFDB:Q64HY5	0.172	0.171	1.986E-10	480	0.212	0.210	Q64HY5.pdb.gz	SP8_CHICK Transcription factor Sp8 OS=Gallus gallus OX=9031 GN=SP8 PE=2 SV=1
9	AFDB:Q8IXZ3	0.172	0.167	8.635E-10	490	0.221	0.214	Q8IXZ3.pdb.gz	SP8_HUMAN Transcription factor Sp8 OS=Homo sapiens OX=9606 GN=SP8 PE=1 SV=3
10	AFDB:O75626	0.184	0.111	2.352E-9	825	0.197	0.114	O75626.pdb.gz	PRDM1_HUMAN PR domain zinc finger protein 1 OS=Homo sapiens OX=9606 GN=PRDM1 PE=1 SV=2
11	PDB:4v88Ah	0.055	0.137	3.497	159	0.057	0.170	4v88Ah.pdb.gz	The structure of the eukaryotic ribosome at 3.0 angstrom resolution.
12	PDB:5dgesM	0.041	0.177	4.569	104	0.017	0.077	5dgesM.pdb.gz	Coping with proline stalling: structural basis of hypusine-induced protein synthesis by the eukaryotic ribosome
13	PDB:4v6iBl	0.043	0.119	4.884	88	0.036	0.193	4v6iBl.pdb.gz	Cryo-EM structure and rRNA model of a translating eukaryotic 80S ribosome at 5.5-A resolution.
14	PDB:6htsR	0.048	0.281	5.582	72	0.019	0.125	6htsR.pdb.gz	Structure and regulation of the human INO80-nucleosome complex.
15	PDB:7ad8D	0.043	0.065	5.582	280	0.021	0.036	7ad8D.pdb.gz	The TFIIH subunits p44/p62 act as a damage sensor during nucleotide excision repair.
16	PDB:3jcmI	0.049	0.056	5.968	416	0.023	0.026	3jcmI.pdb.gz	The 3.8 angstrom structure of the U4/U6.U5 tri-snRNP: Insights into spliceosome assembly and catalysis
17	PDB:4kfzB	0.046	0.114	6.821	148	0.023	0.074	4kfzB.pdb.gz	Conformational flexibility of the oncogenic protein LMO2 primes the formation of the multi-protein transcription complex.
18	PDB:7dvqM	0.036	0.072	6.821	191	0.040	0.099	7dvqM.pdb.gz	Structure of the activated human minor spliceosome.
19	PDB:6cp37	0.049	0.114	7.292	171	0.023	0.064	6cp37.pdb.gz	High-resolution cryo-EM analysis of the yeast ATP synthase in a lipid membrane.
20	PDB:6vk0C	0.065	0.109	7.292	180	0.013	0.033	6vk0C.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P08152	0.0	729	470	0.887	0.898	EGR2_MOUSE E3 SUMO-protein ligase EGR2 OS=Mus musculus OX=10090 GN=Egr2 PE=1 SV=3
2	P11161	0.0	955	476	1.000	1.000	EGR2_HUMAN E3 SUMO-protein ligase EGR2 OS=Homo sapiens OX=9606 GN=EGR2 PE=1 SV=3
3	P51774	0.0	729	470	0.889	0.900	EGR2_RAT E3 SUMO-protein ligase EGR2 OS=Rattus norvegicus OX=10116 GN=Egr2 PE=2 SV=2
4	Q05159	4.18e-180	512	412	0.592	0.684	EGR2B_DANRE Early growth response protein 2b OS=Danio rerio OX=7955 GN=egr2b PE=2 SV=1
5	A0A0S2Z3U4	1.12e-120	353	201	0.357	0.846	A0A0S2Z3U4_HUMAN Early growth response 2 isoform 3 (Fragment) OS=Homo sapiens OX=9606 GN=EGR2 PE=1 SV=1
6	P43300	3.31e-110	333	387	0.450	0.553	EGR3_MOUSE Early growth response protein 3 OS=Mus musculus OX=10090 GN=Egr3 PE=2 SV=2
7	Q06889	7.02e-109	330	387	0.450	0.553	EGR3_HUMAN Early growth response protein 3 OS=Homo sapiens OX=9606 GN=EGR3 PE=2 SV=1
8	P18146	9.62e-78	254	543	0.376	0.330	EGR1_HUMAN Early growth response protein 1 OS=Homo sapiens OX=9606 GN=EGR1 PE=1 SV=1
9	Q546S1	9.62e-78	254	543	0.376	0.330	Q546S1_HUMAN Early growth response protein OS=Homo sapiens OX=9606 GN=EGR1 PE=3 SV=1
10	P08154	3.94e-77	251	508	0.372	0.348	EGR1_RAT Early growth response protein 1 OS=Rattus norvegicus OX=10116 GN=Egr1 PE=1 SV=2
11	A0A0H2UHR3	5.40e-77	252	536	0.372	0.330	A0A0H2UHR3_RAT Early growth response protein OS=Rattus norvegicus OX=10116 GN=Egr1 PE=3 SV=1
12	P08046	2.38e-76	250	533	0.368	0.328	EGR1_MOUSE Early growth response protein 1 OS=Mus musculus OX=10090 GN=Egr1 PE=1 SV=2
13	J7JV33	8.17e-75	246	510	0.363	0.339	J7JV33_TAEGU Early growth response protein OS=Taeniopygia guttata OX=59729 GN=Egr1 PE=2 SV=1
14	A0MWD2	9.28e-75	245	510	0.363	0.339	A0MWD2_TAEGU Early growth response protein OS=Taeniopygia guttata OX=59729 GN=zenk PE=2 SV=1
15	Q5ZLU9	1.95e-74	244	510	0.359	0.335	Q5ZLU9_CHICK Early growth response protein OS=Gallus gallus OX=9031 GN=RCJMB04_4l24 PE=2 SV=1
16	Q8QG62	5.00e-74	243	510	0.361	0.337	Q8QG62_CHICK Early growth response protein OS=Gallus gallus OX=9031 GN=EGR1 PE=2 SV=1
17	P26632	1.43e-70	234	511	0.370	0.344	EGR1_DANRE Early growth response protein 1 OS=Danio rerio OX=7955 GN=egr1 PE=2 SV=2
18	Q26452	6.82e-63	214	512	0.200	0.186	Q26452_DROSP Sr protein (Fragment) OS=Drosophila sp. OX=7242 PE=2 SV=1
19	E1JIP0	1.78e-62	218	717	0.197	0.131	E1JIP0_DROME FI18283p1 OS=Drosophila melanogaster OX=7227 GN=sr PE=2 SV=1
20	A0A0B4KGW2	1.32e-61	219	1271	0.197	0.074	A0A0B4KGW2_DROME Stripe, isoform D OS=Drosophila melanogaster OX=7227 GN=sr PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11928 DUF3446	1.2e-24	97.9	Early growth response N-terminal domain
2	PF02892 zf-BED	17	16.8	BED zinc finger
3	PF00096 zf-C2H2	1e-12	58.9	Zinc finger, C2H2 type
4	PF13894 zf-C2H2_4	1.5e-07	42.7	C2H2-type zinc finger
5	PF13912 zf-C2H2_6	68	14.9	C2H2-type zinc finger
6	PF12171 zf-C2H2_jaz	59	15.4	Zinc-finger double-stranded RNA-binding
7	PF13913 zf-C2HC_2	8.5	17.6	zinc-finger of a C2HC-type
8	PF13465 zf-H2C2_2	5.4e-11	53.6	Zinc-finger double domain
9	PF13909 zf-H2C2_5	1.9e+02	13.2	C2H2-type zinc-finger domain
10	PF16744 zf-RING_15	7e+02	11.7	KIAA1045 RING finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000242480

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000380093	0.987	Transcription factor SOX-10
2	9606.ENSP00000432943	0.980	Myelin protein P0
3	9606.ENSP00000300131	0.975	NGFI-A-binding protein 2
4	9606.ENSP00000362103	0.968	POU domain, class 3, transcription factor 1
5	9606.ENSP00000326018	0.966	Periaxin
6	9606.ENSP00000484631	0.966	Peripheral myelin protein 22
7	9606.ENSP00000318057	0.961	Early growth response protein 3
8	9606.ENSP00000380958	0.958	Myelin basic protein
9	9606.ENSP00000305422	0.950	CCAAT/enhancer-binding protein beta
10	9606.ENSP00000376048	0.949	Myelin-associated glycoprotein
11	9606.ENSP00000234091	0.947	DNA-binding protein inhibitor ID-2
12	9606.ENSP00000329170	0.947	POU domain, class 3, transcription factor 2
13	9606.ENSP00000245919	0.943	Protein fosB
14	9606.ENSP00000265354	0.937	Serum response factor
15	9606.ENSP00000349022	0.932	Activity-regulated cytoskeleton-associated protein
16	9606.ENSP00000367972	0.931	DNA-binding protein inhibitor ID-4
17	9606.ENSP00000445626	0.926	Early growth response protein 4
18	9606.ENSP00000306245	0.915	Proto-oncogene c-Fos
19	9606.ENSP00000316329	0.915	Stearoyl-CoA desaturase 5
20	9606.ENSP00000299759	0.912	GTP-binding protein RAD

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0001228	0.997	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0000977	0.997	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000978	0.994	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0019899	0.928	enzyme binding
GO:0031625	0.880	ubiquitin protein ligase binding
GO:0003682	0.340	chromatin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.989	regulation of cellular process
GO:0032501	0.946	multicellular organismal process
GO:0048856	0.941	anatomical structure development
GO:0060255	0.929	regulation of macromolecule metabolic process
GO:0080090	0.926	regulation of primary metabolic process
GO:0031323	0.926	regulation of cellular metabolic process
GO:0051171	0.925	regulation of nitrogen compound metabolic process
GO:0010468	0.922	regulation of gene expression
GO:0019219	0.915	regulation of nucleobase-containing compound metabolic process
GO:0006355	0.909	regulation of DNA-templated transcription
GO:0007275	0.889	multicellular organism development
GO:0048518	0.841	positive regulation of biological process
GO:0009987	0.835	cellular process
GO:0048522	0.789	positive regulation of cellular process
GO:0010604	0.785	positive regulation of macromolecule metabolic process
GO:0051173	0.749	positive regulation of nitrogen compound metabolic process
GO:0031325	0.707	positive regulation of cellular metabolic process
GO:0006357	0.698	regulation of transcription by RNA polymerase II
GO:0045893	0.698	positive regulation of DNA-templated transcription
GO:0045944	0.665	positive regulation of transcription by RNA polymerase II
GO:0050896	0.643	response to stimulus
GO:0048731	0.500	system development
GO:0048519	0.332	negative regulation of biological process
GO:0048523	0.313	negative regulation of cellular process
GO:0051716	0.305	cellular response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005737	0.704	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]