StarFunc result for job id P11168

User Input

>input (524 residues)
MTEDKVTGTLVFTVITAVLGSFQFGYDIGVINAPQQVIISHYRHVLGVPLDDRKAINNYV
INSTDELPTISYSMNPKPTPWAEEETVAAAQLITMLWSLSVSSFAVGGMTASFFGGWLGD
TLGRIKAMLVANILSLVGALLMGFSKLGPSHILIIAGRSISGLYCGLISGLVPMYIGEIA
PTALRGALGTFHQLAIVTGILISQIIGLEFILGNYDLWHILLGLSGVRAILQSLLLFFCP
ESPRYLYIKLDEEVKAKQSLKRLRGYDDVTKDINEMRKEREEASSEQKVSIIQLFTNSSY
RQPILVALMLHVAQQFSGINGIFYYSTSIFQTAGISKPVYATIGVGAVNMVFTAVSVFLV
EKAGRRSLFLIGMSGMFVCAIFMSVGLVLLNKFSWMSYVSMIAIFLFVSFFEIGPGPIPW
FMVAEFFSQGPRPAALAIAAFSNWTCNFIVALCFQYIADFCGPYVFFLFAGVLLAFTLFT
FFKVPETKGKSFEEIAAEFQKKSGSAHRPKAAVEMKFLGATETV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P11168	1.000	1.000	1.099E-65	524	1.000	1.000	P11168.pdb.gz	GTR2_HUMAN Solute carrier family 2, facilitated glucose transporter member 2 OS=Homo sapiens OX=9606 GN=SLC2A2 PE=1 SV=1
2	AFDB:P14246	0.931	0.933	7.817E-54	523	0.819	0.820	P14246.pdb.gz	GTR2_MOUSE Solute carrier family 2, facilitated glucose transporter member 2 OS=Mus musculus OX=10090 GN=Slc2a2 PE=1 SV=3
3	AFDB:Q90592	0.860	0.846	3.055E-45	533	0.630	0.619	Q90592.pdb.gz	GTR2_CHICK Solute carrier family 2, facilitated glucose transporter member 2 OS=Gallus gallus OX=9031 GN=SLC2A2 PE=2 SV=1
4	AFDB:B0UY92	0.860	0.892	1.861E-42	504	0.569	0.591	B0UY92.pdb.gz
5	AFDB:Q9DFV2	0.851	0.886	2.468E-40	503	0.519	0.541	Q9DFV2.pdb.gz	Q9DFV2_SALTR Muscle glucose transporter OS=Salmo trutta OX=8032 PE=2 SV=1
6	AFDB:Q9I8M1	0.856	0.910	8.969E-40	492	0.508	0.541	Q9I8M1.pdb.gz	Q9I8M1_ONCMY Glucose transporter 1A OS=Oncorhynchus mykiss OX=8022 PE=2 SV=1
7	AFDB:P46896	0.841	0.896	2.039E-39	490	0.525	0.561	P46896.pdb.gz	GTR1_CHICK Solute carrier family 2, facilitated glucose transporter member 1 OS=Gallus gallus OX=9031 GN=SLC2A1 PE=1 SV=1
8	AFDB:Q285P3	0.823	0.881	2.292E-39	488	0.510	0.547	Q285P3.pdb.gz	Q285P3_DANRE Facilitated glucose transporter 1 OS=Danio rerio OX=7955 GN=glut1 PE=1 SV=1
9	AFDB:P11166	0.824	0.875	2.479E-39	492	0.525	0.559	P11166.pdb.gz	GTR1_HUMAN Solute carrier family 2, facilitated glucose transporter member 1 OS=Homo sapiens OX=9606 GN=SLC2A1 PE=1 SV=2
10	AFDB:F1R0Q1	0.812	0.868	9.366E-39	489	0.504	0.540	F1R0Q1.pdb.gz	F1R0Q1_DANRE Solute carrier family 2 member 1b OS=Danio rerio OX=7955 GN=slc2a1b PE=3 SV=2
11	PDB:6thaA	0.802	0.934	1.547E-35	448	0.502	0.587	6thaA.pdb.gz
12	PDB:7sptA	0.814	0.903	1.881E-35	470	0.485	0.540	7sptA.pdb.gz	Molecular basis for inhibiting human glucose transporters by exofacial inhibitors.
13	PDB:7wsmA	0.823	0.926	3.531E-34	464	0.504	0.569	7wsmA.pdb.gz	Cryo-EM structure of human glucose transporter GLUT4.
14	PDB:4ybqB	0.771	0.868	4.271E-26	462	0.385	0.437	4ybqB.pdb.gz
15	PDB:4gbyA	0.735	0.804	1.669E-17	475	0.248	0.274	4gbyA.pdb.gz	Crystal structure of a bacterial homologue of glucose transporters GLUT1-4.
16	PDB:7aaqA	0.735	0.786	3.375E-17	487	0.244	0.263	7aaqA.pdb.gz	Molecular mechanism of sugar transport in plants unveiled by structures of glucose/H + symporter STP10.
17	PDB:4ja4A	0.696	0.816	2.692E-15	442	0.240	0.285	4ja4A.pdb.gz
18	PDB:7zh0A	0.607	0.639	4.590E-9	495	0.156	0.166	7zh0A.pdb.gz
19	PDB:7bc7A	0.535	0.628	8.960E-8	432	0.132	0.160	7bc7A.pdb.gz	Structural basis of antifolate recognition and transport by PCFT.
20	PDB:5oxpA	0.508	0.565	6.329E-7	462	0.135	0.154	5oxpA.pdb.gz	Multispecific Substrate Recognition in a Proton-Dependent Oligopeptide Transporter.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A060VUB5	0.0	536	480	0.513	0.560	A0A060VUB5_ONCMY Major facilitator superfamily (MFS) profile domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00081471001 PE=3 SV=1
2	F1R0Q1	0.0	532	489	0.511	0.548	F1R0Q1_DANRE Solute carrier family 2 member 1b OS=Danio rerio OX=7955 GN=slc2a1b PE=3 SV=2
3	P11166	0.0	551	492	0.531	0.565	GTR1_HUMAN Solute carrier family 2, facilitated glucose transporter member 1 OS=Homo sapiens OX=9606 GN=SLC2A1 PE=1 SV=2
4	P11167	0.0	552	492	0.529	0.563	GTR1_RAT Solute carrier family 2, facilitated glucose transporter member 1 OS=Rattus norvegicus OX=10116 GN=Slc2a1 PE=1 SV=1
5	P11168	0.0	1064	524	1.000	1.000	GTR2_HUMAN Solute carrier family 2, facilitated glucose transporter member 2 OS=Homo sapiens OX=9606 GN=SLC2A2 PE=1 SV=1
6	P12336	0.0	867	522	0.815	0.818	GTR2_RAT Solute carrier family 2, facilitated glucose transporter member 2 OS=Rattus norvegicus OX=10116 GN=Slc2a2 PE=2 SV=1
7	P14246	0.0	874	523	0.819	0.820	GTR2_MOUSE Solute carrier family 2, facilitated glucose transporter member 2 OS=Mus musculus OX=10090 GN=Slc2a2 PE=1 SV=3
8	P17809	0.0	553	492	0.531	0.565	GTR1_MOUSE Solute carrier family 2, facilitated glucose transporter member 1 OS=Mus musculus OX=10090 GN=Slc2a1 PE=1 SV=4
9	P27674	0.0	553	492	0.529	0.563	GTR1_BOVIN Solute carrier family 2, facilitated glucose transporter member 1 OS=Bos taurus OX=9913 GN=SLC2A1 PE=1 SV=1
10	P46896	0.0	539	490	0.525	0.561	GTR1_CHICK Solute carrier family 2, facilitated glucose transporter member 1 OS=Gallus gallus OX=9031 GN=SLC2A1 PE=1 SV=1
11	Q102R8	0.0	610	504	0.584	0.607	Q102R8_DANRE Glucose transporter 2 OS=Danio rerio OX=7955 GN=glut2 PE=1 SV=1
12	Q285P3	0.0	533	488	0.515	0.553	Q285P3_DANRE Facilitated glucose transporter 1 OS=Danio rerio OX=7955 GN=glut1 PE=1 SV=1
13	Q90592	0.0	668	533	0.649	0.638	GTR2_CHICK Solute carrier family 2, facilitated glucose transporter member 2 OS=Gallus gallus OX=9031 GN=SLC2A2 PE=2 SV=1
14	Q9I8M1	0.0	532	492	0.515	0.549	Q9I8M1_ONCMY Glucose transporter 1A OS=Oncorhynchus mykiss OX=8022 PE=2 SV=1
15	Q9DFV2	7.75e-179	514	503	0.519	0.541	Q9DFV2_SALTR Muscle glucose transporter OS=Salmo trutta OX=8032 PE=2 SV=1
16	P11169	6.07e-178	511	496	0.487	0.514	GTR3_HUMAN Solute carrier family 2, facilitated glucose transporter member 3 OS=Homo sapiens OX=9606 GN=SLC2A3 PE=1 SV=1
17	P14672	5.84e-177	509	509	0.519	0.534	GLUT4_HUMAN Solute carrier family 2, facilitated glucose transporter member 4 OS=Homo sapiens OX=9606 GN=SLC2A4 PE=1 SV=1
18	P14142	8.19e-177	509	509	0.515	0.530	GLUT4_MOUSE Solute carrier family 2, facilitated glucose transporter member 4 OS=Mus musculus OX=10090 GN=Slc2a4 PE=1 SV=3
19	P19357	2.66e-176	508	509	0.513	0.528	GLUT4_RAT Solute carrier family 2, facilitated glucose transporter member 4 OS=Rattus norvegicus OX=10116 GN=Slc2a4 PE=1 SV=1
20	A0A060WJ53	5.77e-176	506	477	0.466	0.512	A0A060WJ53_ONCMY Major facilitator superfamily (MFS) profile domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00006116001 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06109 HlyE	6.7e+02	11.0	Haemolysin E (HlyE)
2	PF07690 MFS_1	1.1e-18	78.9	Major Facilitator Superfamily
3	PF03137 OATP	5.1	16.9	Organic Anion Transporter Polypeptide (OATP) family
4	PF00083 Sugar_tr	1e-156	534.0	Sugar (and other) transporter

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000323568

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000223366	0.962	Glucokinase
2	9606.ENSP00000257555	0.962	Hepatocyte nuclear factor 1-alpha
3	9606.ENSP00000266088	0.911	Sodium/glucose cotransporter 1
4	9606.ENSP00000380432	0.876	Insulin
5	9606.ENSP00000378856	0.856	Galectin-9
6	9606.ENSP00000269305	0.845	Cellular tumor antigen p53
7	9606.ENSP00000387662	0.842	Glucagon
8	9606.ENSP00000438483	0.839	Importin subunit alpha-1
9	9606.ENSP00000295886	0.821	Homeobox protein Nkx-6.1
10	9606.ENSP00000242462	0.816	Neurogenin-3
11	9606.ENSP00000327943	0.815	Sodium/glucose cotransporter 2
12	9606.ENSP00000416293	0.811	Solute carrier family 2, facilitated glucose transporter member 1
13	9606.ENSP00000266086	0.799	Solute carrier family 5 member 4
14	9606.ENSP00000370421	0.790	Pancreas/duodenum homeobox protein 1
15	9606.ENSP00000365686	0.773	Solute carrier family 15 member 1
16	9606.ENSP00000253801	0.761	Glucose-6-phosphatase
17	9606.ENSP00000356671	0.758	Antithrombin-III
18	9606.ENSP00000233242	0.756	Apolipoprotein B-100
19	9606.ENSP00000447149	0.748	Bile acid receptor
20	9606.ENSP00000357581	0.744	Homeobox protein Nkx-6.2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008514	0.999	organic anion transmembrane transporter activity
GO:0055056	0.999	D-glucose transmembrane transporter activity
GO:0090482	0.995	vitamin transmembrane transporter activity
GO:0005488	0.820	binding
GO:0005515	0.794	protein binding
GO:0022804	0.310	active transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008645	0.998	hexose transmembrane transport
GO:1904659	0.994	glucose transmembrane transport
GO:0008152	0.770	metabolic process
GO:0051180	0.764	vitamin transport
GO:0071704	0.749	organic substance metabolic process
GO:0044238	0.601	primary metabolic process
GO:0065007	0.370	biological regulation
GO:0050896	0.354	response to stimulus
GO:0050789	0.352	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0043227	0.839	membrane-bounded organelle
GO:0005622	0.816	intracellular anatomical structure
GO:0005737	0.733	cytoplasm
GO:0043229	0.691	intracellular organelle
GO:0043231	0.594	intracellular membrane-bounded organelle
GO:0012505	0.365	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]