StarFunc result for job id P11169

User Input

>input (496 residues)
MGTQKVTPALIFAITVATIGSFQFGYNTGVINAPEKIIKEFINKTLTDKGNAPPSEVLLT
SLWSLSVAIFSVGGMIGSFSVGLFVNRFGRRNSMLIVNLLAVTGGCFMGLCKVAKSVEML
ILGRLVIGLFCGLCTGFVPMYIGEISPTALRGAFGTLNQLGIVVGILVAQIFGLEFILGS
EELWPLLLGFTILPAILQSAALPFCPESPRFLLINRKEEENAKQILQRLWGTQDVSQDIQ
EMKDESARMSQEKQVTVLELFRVSSYRQPIIISIVLQLSQQLSGINAVFYYSTGIFKDAG
VQEPIYATIGAGVVNTIFTVVSLFLVERAGRRTLHMIGLGGMAFCSTLMTVSLLLKDNYN
GMSFVCIGAILVFVAFFEIGPGPIPWFIVAELFSQGPRPAAMAVAGCSNWTSNFLVGLLF
PSAAHYLGAYVFIIFTGFLITFLAFTFFKVPETRGRTFEDITRAFEGQAHGADRSGKDGV
MEMNSIEPAKETTTNV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8TDB8	0.992	0.946	2.928E-61	520	0.946	0.902	Q8TDB8.pdb.gz	GTR14_HUMAN Solute carrier family 2, facilitated glucose transporter member 14 OS=Homo sapiens OX=9606 GN=SLC2A14 PE=2 SV=1
2	AFDB:P32037	0.986	0.992	3.110E-55	493	0.829	0.834	P32037.pdb.gz	GTR3_MOUSE Solute carrier family 2, facilitated glucose transporter member 3 OS=Mus musculus OX=10090 GN=Slc2a3 PE=1 SV=1
3	PDB:7sptA	0.938	0.989	6.474E-54	470	0.942	0.994	7sptA.pdb.gz	Molecular basis for inhibiting human glucose transporters by exofacial inhibitors.
4	AFDB:P11166	0.950	0.957	6.517E-49	492	0.639	0.644	P11166.pdb.gz	GTR1_HUMAN Solute carrier family 2, facilitated glucose transporter member 1 OS=Homo sapiens OX=9606 GN=SLC2A1 PE=1 SV=2
5	AFDB:Q285P3	0.952	0.968	1.012E-48	488	0.623	0.633	Q285P3.pdb.gz	Q285P3_DANRE Facilitated glucose transporter 1 OS=Danio rerio OX=7955 GN=glut1 PE=1 SV=1
6	AFDB:A0A286Y8I9	0.934	0.842	6.367E-48	550	0.643	0.580	A0A286Y8I9.pdb.gz
7	AFDB:F1R0Q1	0.939	0.953	9.884E-48	489	0.617	0.626	F1R0Q1.pdb.gz	F1R0Q1_DANRE Solute carrier family 2 member 1b OS=Danio rerio OX=7955 GN=slc2a1b PE=3 SV=2
8	AFDB:P46896	0.939	0.951	1.308E-47	490	0.635	0.643	P46896.pdb.gz	GTR1_CHICK Solute carrier family 2, facilitated glucose transporter member 1 OS=Gallus gallus OX=9031 GN=SLC2A1 PE=1 SV=1
9	AFDB:F1NTJ1	0.874	0.874	1.690E-46	496	0.728	0.728	F1NTJ1.pdb.gz	F1NTJ1_CHICK Solute carrier family 2, facilitated glucose transporter member 3 OS=Gallus gallus OX=9031 GN=SLC2A14 PE=3 SV=2
10	AFDB:P14142	0.943	0.919	6.036E-44	509	0.573	0.558	P14142.pdb.gz	GLUT4_MOUSE Solute carrier family 2, facilitated glucose transporter member 4 OS=Mus musculus OX=10090 GN=Slc2a4 PE=1 SV=3
11	AFDB:Q9I8M1	0.859	0.865	1.707E-43	492	0.619	0.624	Q9I8M1.pdb.gz	Q9I8M1_ONCMY Glucose transporter 1A OS=Oncorhynchus mykiss OX=8022 PE=2 SV=1
12	PDB:6thaA	0.793	0.871	1.614E-39	448	0.613	0.679	6thaA.pdb.gz
13	PDB:7wsmA	0.808	0.859	5.501E-35	464	0.562	0.601	7wsmA.pdb.gz	Cryo-EM structure of human glucose transporter GLUT4.
14	PDB:4ybqB	0.871	0.933	3.282E-30	462	0.403	0.433	4ybqB.pdb.gz
15	PDB:4gbyA	0.817	0.851	3.814E-21	475	0.276	0.288	4gbyA.pdb.gz	Crystal structure of a bacterial homologue of glucose transporters GLUT1-4.
16	PDB:7aaqA	0.819	0.834	2.980E-19	487	0.256	0.261	7aaqA.pdb.gz	Molecular mechanism of sugar transport in plants unveiled by structures of glucose/H + symporter STP10.
17	PDB:4ja4A	0.669	0.740	4.864E-16	442	0.270	0.303	4ja4A.pdb.gz
18	PDB:7zh0A	0.661	0.662	2.662E-9	495	0.171	0.172	7zh0A.pdb.gz
19	PDB:7bc7A	0.585	0.659	2.400E-8	432	0.125	0.144	7bc7A.pdb.gz	Structural basis of antifolate recognition and transport by PCFT.
20	PDB:6s4mA	0.597	0.684	3.879E-8	426	0.137	0.160	6s4mA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A060VUB5	624	480	0.615	0.635	A0A060VUB5_ONCMY Major facilitator superfamily (MFS) profile domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00081471001 PE=3 SV=1
2	A0A060WJ53	577	477	0.581	0.604	A0A060WJ53_ONCMY Major facilitator superfamily (MFS) profile domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00006116001 PE=4 SV=1
3	F1NTJ1	733	496	0.726	0.726	F1NTJ1_CHICK Solute carrier family 2, facilitated glucose transporter member 3 OS=Gallus gallus OX=9031 GN=SLC2A14 PE=3 SV=2
4	F1R0Q1	639	489	0.629	0.638	F1R0Q1_DANRE Solute carrier family 2 member 1b OS=Danio rerio OX=7955 GN=slc2a1b PE=3 SV=2
5	P11166	646	492	0.633	0.638	GTR1_HUMAN Solute carrier family 2, facilitated glucose transporter member 1 OS=Homo sapiens OX=9606 GN=SLC2A1 PE=1 SV=2
6	P11167	645	492	0.639	0.644	GTR1_RAT Solute carrier family 2, facilitated glucose transporter member 1 OS=Rattus norvegicus OX=10116 GN=Slc2a1 PE=1 SV=1
7	P11169	999	496	1.000	1.000	GTR3_HUMAN Solute carrier family 2, facilitated glucose transporter member 3 OS=Homo sapiens OX=9606 GN=SLC2A3 PE=1 SV=1
8	P14142	535	509	0.573	0.558	GLUT4_MOUSE Solute carrier family 2, facilitated glucose transporter member 4 OS=Mus musculus OX=10090 GN=Slc2a4 PE=1 SV=3
9	P14672	534	509	0.573	0.558	GLUT4_HUMAN Solute carrier family 2, facilitated glucose transporter member 4 OS=Homo sapiens OX=9606 GN=SLC2A4 PE=1 SV=1
10	P17809	647	492	0.635	0.640	GTR1_MOUSE Solute carrier family 2, facilitated glucose transporter member 1 OS=Mus musculus OX=10090 GN=Slc2a1 PE=1 SV=4
11	P19357	529	509	0.569	0.554	GLUT4_RAT Solute carrier family 2, facilitated glucose transporter member 4 OS=Rattus norvegicus OX=10116 GN=Slc2a4 PE=1 SV=1
12	P27674	650	492	0.635	0.640	GTR1_BOVIN Solute carrier family 2, facilitated glucose transporter member 1 OS=Bos taurus OX=9913 GN=SLC2A1 PE=1 SV=1
13	P28568	731	496	0.724	0.724	GTR3_CHICK Solute carrier family 2, facilitated glucose transporter member 3 OS=Gallus gallus OX=9031 GN=SLC2A3 PE=2 SV=1
14	P32037	812	493	0.829	0.834	GTR3_MOUSE Solute carrier family 2, facilitated glucose transporter member 3 OS=Mus musculus OX=10090 GN=Slc2a3 PE=1 SV=1
15	P46896	640	490	0.635	0.643	GTR1_CHICK Solute carrier family 2, facilitated glucose transporter member 1 OS=Gallus gallus OX=9031 GN=SLC2A1 PE=1 SV=1
16	Q07647	828	493	0.825	0.830	GTR3_RAT Solute carrier family 2, facilitated glucose transporter member 3 OS=Rattus norvegicus OX=10116 GN=Slc2a3 PE=1 SV=1
17	Q285P3	633	488	0.625	0.635	Q285P3_DANRE Facilitated glucose transporter 1 OS=Danio rerio OX=7955 GN=glut1 PE=1 SV=1
18	Q6DFZ5	626	541	0.631	0.579	Q6DFZ5_DANRE Solute carrier family 2 member 3a OS=Danio rerio OX=7955 GN=zgc:92476 PE=1 SV=1
19	Q8TDB8	947	520	0.946	0.902	GTR14_HUMAN Solute carrier family 2, facilitated glucose transporter member 14 OS=Homo sapiens OX=9606 GN=SLC2A14 PE=2 SV=1
20	Q9DFV2	556	503	0.579	0.571	Q9DFV2_SALTR Muscle glucose transporter OS=Salmo trutta OX=8032 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04463 2-thiour_desulf	2.8e+02	12.9	2-thiouracil desulfurase
2	PF08936 CsoSCA	8.1e+02	10.0	Carboxysome Shell Carbonic Anhydrase
3	PF07690 MFS_1	2.8e-12	57.8	Major Facilitator Superfamily
4	PF00083 Sugar_tr	3e-153	522.6	Sugar (and other) transporter

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000075120

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000387699	0.923	Cyclic AMP-responsive element-binding protein 1
2	9606.ENSP00000395535	0.909	Methyl-CpG-binding protein 2
3	9606.ENSP00000445929	0.866	Solute carrier family 2, facilitated glucose transporter member 14
4	9606.ENSP00000445175	0.743	Lactate dehydrogenase A
5	9606.ENSP00000463978	0.736	Monocarboxylate transporter 4
6	9606.ENSP00000437955	0.730	Hypoxia-inducible factor 1-alpha
7	9606.ENSP00000358794	0.729	Monocarboxylate transporter 5
8	9606.ENSP00000290573	0.720	Hexokinase-2
9	9606.ENSP00000320171	0.698	Pyruvate kinase PKM
10	9606.ENSP00000328551	0.681	Ras-related protein Rab-28
11	9606.ENSP00000380432	0.673	Insulin
12	9606.ENSP00000261187	0.665	Monocarboxylate transporter 2
13	9606.ENSP00000266088	0.650	Sodium/glucose cotransporter 1
14	9606.ENSP00000229332	0.648	C-type lectin domain family 4 member A
15	9606.ENSP00000286713	0.636	Erythrocyte band 7 integral membrane protein
16	9606.ENSP00000402103	0.633	Catalyzes the phosphorylation of various hexoses, such as D- glucose, D-glucosamine, D-fructose, D-mannose and 2-deoxy-D-glucose, to hexose 6-phosphate (D-glucose 6-phosphate, D-glucosamine 6-phosphate, D-fructose 6-phosphate, D-mannose 6-phosphate and 2-deoxy-D-glucose 6- phosphate, respectively) (PubMed:1637300, PubMed:25316723, PubMed:27374331). Does not phosphorylate N-acetyl-D-glucosamine . Mediates the initial step of glycolysis by catalyzing phosphorylation of D-glucose to D-glucose 6-phosphate (By similarity). Involved in innate immunity and inflammation by acting as a pattern [...]
17	9606.ENSP00000376352	0.629	[Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 1, mitochondrial
18	9606.ENSP00000256689	0.626	Sodium-coupled neutral amino acid transporter 2
19	9606.ENSP00000345771	0.615	ATP-dependent 6-phosphofructokinase, muscle type
20	9606.ENSP00000368637	0.614	Solute carrier family 23 member 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005355	1.000	glucose transmembrane transporter activity
GO:0008514	0.999	organic anion transmembrane transporter activity
GO:0090482	0.997	vitamin transmembrane transporter activity
GO:0005488	0.837	binding
GO:0055056	0.820	D-glucose transmembrane transporter activity
GO:0005515	0.804	protein binding
GO:0022804	0.661	active transmembrane transporter activity
GO:0015291	0.550	secondary active transmembrane transporter activity
GO:0015318	0.387	inorganic molecular entity transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:1904659	0.989	glucose transmembrane transport
GO:0065007	0.484	biological regulation
GO:0008152	0.478	metabolic process
GO:0071704	0.474	organic substance metabolic process
GO:0050789	0.408	regulation of biological process
GO:0015711	0.396	organic anion transport
GO:0050794	0.338	regulation of cellular process
GO:0044238	0.311	primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.998	plasma membrane
GO:0043227	0.976	membrane-bounded organelle
GO:0043229	0.965	intracellular organelle
GO:0043231	0.959	intracellular membrane-bounded organelle
GO:0005737	0.930	cytoplasm
GO:0031982	0.906	vesicle
GO:0005576	0.898	extracellular region
GO:0012505	0.883	endomembrane system
GO:0005615	0.846	extracellular space
GO:0005634	0.647	nucleus
GO:1903561	0.445	extracellular vesicle
GO:0070062	0.413	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]