StarFunc result for job id P11171

User Input

>input (864 residues)
MTTEKSLVTEAENSQHQQKEEGEEAINSGQQEPQQEESCQTAAEGDNWCEQKLKASNGDT
PTHEDLTKNKERTSESRGLSRLFSSFLKRPKSQVSEEEGKEVESDKEKGEGGQKEIEFGT
SLDEEIILKAPIAAPEPELKTDPSLDLHSLSSAETQPAQEELREDPDFEIKEGEGLEECS
KIEVKEESPQSKAETELKASQKPIRKHRNMHCKVSLLDDTVYECVVEKHAKGQDLLKRVC
EHLNLLEEDYFGLAIWDNATSKTWLDSAKEIKKQVRGVPWNFTFNVKFYPPDPAQLTEDI
TRYYLCLQLRQDIVAGRLPCSFATLALLGSYTIQSELGDYDPELHGVDYVSDFKLAPNQT
KELEEKVMELHKSYRSMTPAQADLEFLENAKKLSMYGVDLHKAKDLEGVDIILGVCSSGL
LVYKDKLRINRFPWPKVLKISYKRSSFFIKIRPGEQEQYESTIGFKLPSYRAAKKLWKVC
VEHHTFFRLTSTDTIPKSKFLALGSKFRYSGRTQAQTRQASALIDRPAPHFERTASKRAS
RSLDGAAAVDSADRSPRPTSAPAITQGQVAEGGVLDASAKKTVVPKAQKETVKAEVKKED
EPPEQAEPEPTEAWKVEKTHIEVTVPTSNGDQTQKLAEKTEDLIRMRKKKRERLDGENIY
IRHSNLMLEDLDKSQEEIKKHHASISELKKNFMESVPEPRPSEWDKRLSTHSPFRTLNIN
GQIPTGEGPPLVKTQTVTISDNANAVKSEIPTKDVPIVHTETKTITYEAAQTDDNSGDLD
PGVLLTAQTITSETPSSTTTTQITKTVKGGISETRIEKRIVITGDADIDHDQVLVQAIKE
AKEQHPDMSVTKVVVHQETEIADE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0G2K161	0.499	0.498	0.000	866	0.883	0.881	A0A0G2K161.pdb.gz	A0A0G2K161_RAT Protein 4.1 OS=Rattus norvegicus OX=10116 GN=Epb41 PE=1 SV=2
2	AFDB:D4A9A6	0.537	0.562	0.000	820	0.861	0.907	D4A9A6.pdb.gz	D4A9A6_RAT Protein 4.1 OS=Rattus norvegicus OX=10116 GN=Epb41 PE=1 SV=2
3	AFDB:P11171	1.000	1.000	0.000	864	1.000	1.000	P11171.pdb.gz	EPB41_HUMAN Protein 4.1 OS=Homo sapiens OX=9606 GN=EPB41 PE=1 SV=4
4	AFDB:A0A3B3IU06	0.423	0.452	1.077E-96	807	0.833	0.892	A0A3B3IU06.pdb.gz	A0A3B3IU06_HUMAN Protein 4.1 OS=Homo sapiens OX=9606 GN=EPB41 PE=1 SV=1
5	AFDB:A0A0G2KAK2	0.422	0.563	7.426E-85	638	0.668	0.904	A0A0G2KAK2.pdb.gz	A0A0G2KAK2_RAT Protein 4.1 OS=Rattus norvegicus OX=10116 GN=Epb41 PE=1 SV=2
6	AFDB:O43491	0.460	0.402	7.416E-72	1005	0.521	0.448	O43491.pdb.gz	E41L2_HUMAN Band 4.1-like protein 2 OS=Homo sapiens OX=9606 GN=EPB41L2 PE=1 SV=1
7	AFDB:E9PHY5	0.428	0.397	1.472E-70	935	0.497	0.459	E9PHY5.pdb.gz	E9PHY5_HUMAN Erythrocyte membrane protein band 4.1 like 2 OS=Homo sapiens OX=9606 GN=EPB41L2 PE=1 SV=1
8	AFDB:O70318	0.473	0.418	3.811E-68	988	0.532	0.466	O70318.pdb.gz	E41L2_MOUSE Band 4.1-like protein 2 OS=Mus musculus OX=10090 GN=Epb41l2 PE=1 SV=2
9	AFDB:A0A0A0MRA8	0.415	0.391	3.115E-66	918	0.493	0.464	A0A0A0MRA8.pdb.gz	A0A0A0MRA8_HUMAN Erythrocyte membrane protein band 4.1 like 3 OS=Homo sapiens OX=9606 GN=EPB41L3 PE=1 SV=1
10	AFDB:E9PII3	0.481	0.584	1.764E-64	706	0.458	0.561	E9PII3.pdb.gz	E9PII3_HUMAN Erythrocyte membrane protein band 4.1 like 2 OS=Homo sapiens OX=9606 GN=EPB41L2 PE=1 SV=1
11	PDB:4rm8A	0.306	0.695	3.036E-22	368	0.102	0.239	4rm8A.pdb.gz
12	PDB:6r9tA	0.159	0.069	1.629E-7	2185	0.041	0.016	6r9tA.pdb.gz
13	PDB:7c3mA	0.255	0.372	7.852E-7	577	0.060	0.090	7c3mA.pdb.gz
14	PDB:6mdhA	0.084	0.460	1.147E-3	149	0.016	0.094	6mdhA.pdb.gz
15	PDB:3dbhI	0.088	0.754	1.414E-3	86	0.015	0.151	3dbhI.pdb.gz	Structural dissection of a gating mechanism preventing misactivation of ubiquitin by NEDD8's E1.
16	PDB:7rbsB	0.084	0.430	1.838E-3	157	0.010	0.057	7rbsB.pdb.gz	Dual domain recognition determines SARS-CoV-2 PLpro selectivity for human ISG15 and K48-linked di-ubiquitin.
17	PDB:4pyuA	0.084	0.829	2.041E-3	76	0.008	0.092	4pyuA.pdb.gz	The conserved ubiquitin-like protein Hub1 plays a critical role in splicing in human cells.
18	PDB:6yvaC	0.081	0.418	4.722E-3	155	0.013	0.071	6yvaC.pdb.gz
19	PDB:3tixA	0.097	0.413	5.526E-3	153	0.028	0.157	3tixA.pdb.gz
20	PDB:2y3aA	0.090	0.080	7.569E-3	976	0.024	0.022	2y3aA.pdb.gz	Structure of Lipid Kinase P110Beta-P85Beta Elucidates an Unusual Sh2-Domain-Mediated Inhibitory Mechanism.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0A0MRA8	596	918	0.361	0.340	A0A0A0MRA8_HUMAN Erythrocyte membrane protein band 4.1 like 3 OS=Homo sapiens OX=9606 GN=EPB41L3 PE=1 SV=1
2	A0A0C4DH22	563	880	0.307	0.301	A0A0C4DH22_HUMAN Erythrocyte membrane protein band 4.1 like 1 OS=Homo sapiens OX=9606 GN=EPB41L1 PE=1 SV=1
3	A0A0G2K161	1219	764	0.736	0.832	A0A0G2K161_RAT Protein 4.1 OS=Rattus norvegicus OX=10116 GN=Epb41 PE=1 SV=2
4	A0A0G2K1Q9	603	943	0.380	0.348	A0A0G2K1Q9_RAT Erythrocyte membrane protein band 4.1-like 3 OS=Rattus norvegicus OX=10116 GN=Epb41l3 PE=4 SV=2
5	A0A0G2KAK2	1149	637	0.678	0.920	A0A0G2KAK2_RAT Protein 4.1 OS=Rattus norvegicus OX=10116 GN=Epb41 PE=1 SV=2
6	A0A1B0GTW6	566	1595	0.304	0.165	A0A1B0GTW6_HUMAN Erythrocyte membrane protein band 4.1 like 1 OS=Homo sapiens OX=9606 GN=EPB41L1 PE=1 SV=2
7	A0A2R8Y570	1448	766	0.818	0.923	A0A2R8Y570_HUMAN Protein 4.1 OS=Homo sapiens OX=9606 GN=EPB41 PE=1 SV=1
8	A0A2R8Y5B3	580	824	0.359	0.376	A0A2R8Y5B3_HUMAN Erythrocyte membrane protein band 4.1 like 2 (Fragment) OS=Homo sapiens OX=9606 GN=EPB41L2 PE=1 SV=1
9	A0A2R8Y5G2	1506	782	0.843	0.931	A0A2R8Y5G2_HUMAN Protein 4.1 OS=Homo sapiens OX=9606 GN=EPB41 PE=1 SV=1
10	A0A2R8Y5Z6	1504	787	0.843	0.925	A0A2R8Y5Z6_HUMAN Protein 4.1 OS=Homo sapiens OX=9606 GN=EPB41 PE=1 SV=1
11	A0A2R8Y6G5	1344	680	0.771	0.979	A0A2R8Y6G5_HUMAN Protein 4.1 OS=Homo sapiens OX=9606 GN=EPB41 PE=1 SV=1
12	A0A2R8Y7Y3	1197	601	0.685	0.985	A0A2R8Y7Y3_HUMAN Protein 4.1 OS=Homo sapiens OX=9606 GN=EPB41 PE=1 SV=1
13	A0A2R8YCW8	1233	748	0.733	0.846	A0A2R8YCW8_HUMAN Erythrocyte membrane protein band 4.1 OS=Homo sapiens OX=9606 GN=EPB41 PE=1 SV=1
14	A0A2R8YD30	1361	655	0.758	1.000	A0A2R8YD30_HUMAN Protein 4.1 OS=Homo sapiens OX=9606 GN=EPB41 PE=1 SV=1
15	A0A2R8YFR9	1345	675	0.771	0.987	A0A2R8YFR9_HUMAN Protein 4.1 (Fragment) OS=Homo sapiens OX=9606 GN=EPB41 PE=1 SV=1
16	A0A2U3TZH6	1678	841	0.959	0.986	A0A2U3TZH6_HUMAN Protein 4.1 OS=Homo sapiens OX=9606 GN=EPB41 PE=1 SV=1
17	A0A3B3IU06	1448	807	0.818	0.876	A0A3B3IU06_HUMAN Protein 4.1 OS=Homo sapiens OX=9606 GN=EPB41 PE=1 SV=1
18	A0A3B3IUD6	926	607	0.516	0.735	A0A3B3IUD6_HUMAN Erythrocyte membrane protein band 4.1 OS=Homo sapiens OX=9606 GN=EPB41 PE=1 SV=1
19	A0A8I5Y1G9	634	933	0.395	0.365	A0A8I5Y1G9_RAT Erythrocyte membrane protein band 4.1-like 3 OS=Rattus norvegicus OX=10116 GN=Epb41l3 PE=1 SV=1
20	A0A8I5Y1T6	1185	975	0.718	0.636	A0A8I5Y1T6_RAT Protein 4.1 OS=Rattus norvegicus OX=10116 GN=Epb41 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05902 4_1_CTD	2.7e-47	170.6	4.1 protein C-terminal domain (CTD)
2	PF19308 CRISPR_Cas6_N	3.8e+02	12.7	CRISPR Cas6 N-terminal domain
3	PF08736 FA	2.6e-16	70.6	FERM adjacent (FA)
4	PF09380 FERM_C	4.1e-22	89.7	FERM C-terminal PH-like domain
5	PF00373 FERM_M	2.2e-17	74.9	FERM central domain
6	PF09379 FERM_N	5.6e-18	75.9	FERM N-terminal domain
7	PF04382 SAB	8.1e-19	78.8	SAB domain
8	PF10686 YAcAr	4.8e+02	12.2	YspA, cpYpsA-related SLOG family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000345259

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000259254	0.994	Glycophorin-C
2	9606.ENSP00000367408	0.991	Peripheral plasma membrane protein CASK
3	9606.ENSP00000345731	0.989	Disks large homolog 1
4	9606.ENSP00000369027	0.967	Short transient receptor potential channel 4
5	9606.ENSP00000307046	0.966	Syndecan-2
6	9606.ENSP00000377298	0.953	Nuclear mitotic apparatus protein 1
7	9606.ENSP00000354778	0.938	Contactin-associated protein-like 2
8	9606.ENSP00000451648	0.931	Neurexin-3
9	9606.ENSP00000398632	0.905	CD44 antigen
10	9606.ENSP00000262418	0.897	Band 3 anion transport protein
11	9606.ENSP00000264638	0.825	Contactin-associated protein 1
12	9606.ENSP00000385142	0.815	Neurexin-1
13	9606.ENSP00000361824	0.814	Spectrin alpha chain, non-erythrocytic 1
14	9606.ENSP00000300215	0.801	Erythrocyte membrane protein band 4.2
15	9606.ENSP00000362680	0.798	Proto-oncogene tyrosine-protein kinase Src
16	9606.ENSP00000451752	0.795	Spectrin beta chain, erythrocytic
17	9606.ENSP00000259365	0.793	Tropomodulin-1
18	9606.ENSP00000354623	0.777	Whirlin
19	9606.ENSP00000354003	0.776	Glycophorin-A
20	9606.ENSP00000427866	0.773	Dematin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008092	0.999	cytoskeletal protein binding
GO:0003779	0.919	actin binding
GO:0044877	0.443	protein-containing complex binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.970	regulation of cellular process
GO:0009987	0.968	cellular process
GO:0048518	0.879	positive regulation of biological process
GO:0071840	0.832	cellular component organization or biogenesis
GO:0048522	0.826	positive regulation of cellular process
GO:0016043	0.755	cellular component organization
GO:0060341	0.735	regulation of cellular localization
GO:0044093	0.729	positive regulation of molecular function
GO:0032880	0.710	regulation of protein localization
GO:0043393	0.636	regulation of protein binding
GO:1903829	0.610	positive regulation of protein localization
GO:0044085	0.537	cellular component biogenesis
GO:0051099	0.525	positive regulation of binding
GO:1904375	0.497	regulation of protein localization to cell periphery
GO:1904377	0.491	positive regulation of protein localization to cell periphery
GO:0022607	0.469	cellular component assembly
GO:0050793	0.311	regulation of developmental process
GO:0032501	0.305	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005886	1.000	plasma membrane
GO:0030054	0.999	cell junction
GO:0031981	0.995	nuclear lumen
GO:0043232	0.993	intracellular non-membrane-bounded organelle
GO:0005654	0.993	nucleoplasm
GO:0005829	0.989	cytosol
GO:0005856	0.983	cytoskeleton
GO:0015630	0.918	microtubule cytoskeleton
GO:0005819	0.803	spindle
GO:0045171	0.802	intercellular bridge
GO:0072686	0.770	mitotic spindle
GO:0016604	0.368	nuclear body

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]