StarFunc result for job id P11172

User Input

>input (480 residues)
MAVARAALGPLVTGLYDVQAFKFGDFVLKSGLSSPIYIDLRGIVSRPRLLSQVADILFQT
AQNAGISFDTVCGVPYTALPLATVICSTNQIPMLIRRKETKDYGTKRLVEGTINPGETCL
IIEDVVTSGSSVLETVEVLQKEGLKVTDAIVLLDREQGGKDKLQAHGIRLHSVCTLSKML
EILEQQKKVDAETVGRVKRFIQENVFVAANHNGSPLSIKEAPKELSFGARAELPRIHPVA
SKLLRLMQKKETNLCLSADVSLARELLQLADALGPSICMLKTHVDILNDFTLDVMKELIT
LAKCHEFLIFEDRKFADIGNTVKKQYEGGIFKIASWADLVNAHVVPGSGVVKGLQEVGLP
LHRGCLLIAEMSSTGSLATGDYTRAAVRMAEEHSEFVVGFISGSRVSMKPEFLHLTPGVQ
LEAGGDNLGQQYNSPQEVIGKRGSDIIIVGRGIISAADRLEAAEMYRKAAWEAYLSRLGV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P11172	1.000	1.000	2.247E-96	480	1.000	1.000	P11172.pdb.gz	UMPS_HUMAN Uridine 5'-monophosphate synthase OS=Homo sapiens OX=9606 GN=UMPS PE=1 SV=1
2	AFDB:P13439	0.977	0.975	3.204E-89	481	0.885	0.884	P13439.pdb.gz	UMPS_MOUSE Uridine 5'-monophosphate synthase OS=Mus musculus OX=10090 GN=Umps PE=1 SV=3
3	AFDB:Q42586	0.537	0.542	4.444E-65	476	0.542	0.546	Q42586.pdb.gz	UMPS_ARATH Uridine 5'-monophosphate synthase OS=Arabidopsis thaliana OX=3702 GN=PYRE-F PE=2 SV=2
4	AFDB:P09556	0.573	0.576	1.063E-60	478	0.463	0.464	P09556.pdb.gz	UMPS_DICDI Uridine 5'-monophosphate synthase OS=Dictyostelium discoideum OX=44689 GN=pyr56 PE=1 SV=2
5	AFDB:Q01637	0.531	0.517	4.261E-59	493	0.477	0.465	Q01637.pdb.gz	UMPS_DROME Uridine 5'-monophosphate synthase OS=Drosophila melanogaster OX=7227 GN=r-l PE=2 SV=2
6	AFDB:G5EDZ2	0.527	0.509	1.021E-49	497	0.375	0.362	G5EDZ2.pdb.gz	UMPS_CAEEL Uridine 5'-monophosphate synthase OS=Caenorhabditis elegans OX=6239 GN=umps-1 PE=1 SV=1
7	AFDB:P14965	0.519	0.936	1.703E-33	264	0.275	0.500	P14965.pdb.gz	PYRF_SCHPO Orotidine 5'-phosphate decarboxylase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ura4 PE=3 SV=1
8	AFDB:O13410	0.510	0.872	4.206E-31	278	0.279	0.482	O13410.pdb.gz	PYRF_ASPFU Orotidine 5'-phosphate decarboxylase OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=pyrG PE=3 SV=1
9	AFDB:P03962	0.515	0.918	5.854E-31	267	0.271	0.487	P03962.pdb.gz	PYRF_YEAST Orotidine 5'-phosphate decarboxylase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=URA3 PE=1 SV=2
10	AFDB:P33283	0.518	0.929	1.073E-30	265	0.285	0.517	P33283.pdb.gz	PYRF_CANGA Orotidine 5'-phosphate decarboxylase OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=URA3 PE=3 SV=1
11	PDB:1dqxA	0.520	0.925	9.139E-30	267	0.271	0.487	1dqxA.pdb.gz	Anatomy of a proficient enzyme: the structure of orotidine 5'-monophosphate decarboxylase in the presence and absence of a potential transition state analog.
12	PDB:2ps1A	0.385	0.793	8.593E-16	224	0.117	0.250	2ps1A.pdb.gz	Ternary complex formation and induced asymmetry in orotate phosphoribosyltransferase.
13	PDB:1oroA	0.360	0.750	3.121E-13	213	0.115	0.258	1oroA.pdb.gz	A flexible loop at the dimer interface is a part of the active site of the adjacent monomer of Escherichia coli orotate phosphoribosyltransferase.
14	PDB:2dy0A	0.270	0.642	1.212E-9	182	0.067	0.176	2dy0A.pdb.gz
15	PDB:1eixC	0.379	0.728	8.805E-9	232	0.085	0.177	1eixC.pdb.gz	Structural basis for the catalytic mechanism of a proficient enzyme: orotidine 5'-monophosphate decarboxylase.
16	PDB:1xbzB	0.334	0.678	9.943E-8	216	0.073	0.162	1xbzB.pdb.gz	Evolution of enzymatic activities in the orotidine 5'-monophosphate decarboxylase suprafamily: structural basis for catalytic promiscuity in wild-type and designed mutants of 3-keto-L-gulonate 6-phosphate decarboxylase
17	PDB:3s9yA	0.379	0.526	2.035E-7	331	0.117	0.169	3s9yA.pdb.gz	Structure-activity relationships of orotidine-5'-monophosphate decarboxylase inhibitors as anticancer agents.
18	PDB:6fciA	0.276	0.676	4.650E-7	179	0.048	0.128	6fciA.pdb.gz	Structural Insights into the Forward and Reverse Enzymatic Reactions in Human Adenine Phosphoribosyltransferase.
19	PDB:5vn4A	0.287	0.538	9.007E-7	237	0.071	0.143	5vn4A.pdb.gz	Crystal structure of adenine phosphoribosyl transferase from Trypanosoma brucei in complex with AMP, pyrophosphate, and ribose-5-phosphate
20	PDB:5vjpB	0.263	0.627	1.063E-6	179	0.050	0.134	5vjpB.pdb.gz	Synthesis of bis-Phosphate Iminoaltritol Enantiomers and Structural Characterization with Adenine Phosphoribosyltransferase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F7FPV0	0.0	882	494	0.894	0.868	F7FPV0_RAT Uridine 5'-monophosphate synthase OS=Rattus norvegicus OX=10116 GN=Umps PE=1 SV=1
2	P11172	0.0	981	480	1.000	1.000	UMPS_HUMAN Uridine 5'-monophosphate synthase OS=Homo sapiens OX=9606 GN=UMPS PE=1 SV=1
3	P13439	0.0	877	481	0.887	0.886	UMPS_MOUSE Uridine 5'-monophosphate synthase OS=Mus musculus OX=10090 GN=Umps PE=1 SV=3
4	Q42586	0.0	522	476	0.546	0.550	UMPS_ARATH Uridine 5'-monophosphate synthase OS=Arabidopsis thaliana OX=3702 GN=PYRE-F PE=2 SV=2
5	P09556	3.42e-146	428	478	0.465	0.467	UMPS_DICDI Uridine 5'-monophosphate synthase OS=Dictyostelium discoideum OX=44689 GN=pyr56 PE=1 SV=2
6	Q01637	1.05e-144	425	493	0.471	0.458	UMPS_DROME Uridine 5'-monophosphate synthase OS=Drosophila melanogaster OX=7227 GN=r-l PE=2 SV=2
7	G5EDZ2	1.21e-100	312	497	0.381	0.368	UMPS_CAEEL Uridine 5'-monophosphate synthase OS=Caenorhabditis elegans OX=6239 GN=umps-1 PE=1 SV=1
8	P14965	1.95e-84	263	264	0.275	0.500	PYRF_SCHPO Orotidine 5'-phosphate decarboxylase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ura4 PE=3 SV=1
9	O13410	5.62e-84	262	278	0.273	0.471	PYRF_ASPFU Orotidine 5'-phosphate decarboxylase OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=pyrG PE=3 SV=1
10	P33283	2.63e-82	257	265	0.290	0.525	PYRF_CANGA Orotidine 5'-phosphate decarboxylase OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=URA3 PE=3 SV=1
11	P03962	1.47e-79	250	267	0.269	0.483	PYRF_YEAST Orotidine 5'-phosphate decarboxylase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=URA3 PE=1 SV=2
12	A2QZ43	1.28e-78	248	280	0.267	0.457	A2QZ43_ASPNC Orotidine 5'-phosphate decarboxylase OS=Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513) OX=425011 GN=pyrA PE=3 SV=1
13	P10652	3.74e-75	239	274	0.258	0.453	PYRF_EMENI Orotidine 5'-phosphate decarboxylase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pyrG PE=3 SV=2
14	O61790	6.11e-49	169	227	0.169	0.357	PYRE_CAEEL Orotate phosphoribosyltransferase OS=Caenorhabditis elegans OX=6239 GN=R12E2.11 PE=1 SV=1
15	Q57U85	6.81e-38	146	458	0.158	0.166	Q57U85_TRYB2 Orotidine-5-phosphate decarboxylase/orotate phosphoribosyltransferase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.6E7.750 PE=3 SV=1
16	P13298	1.03e-19	90.1	226	0.123	0.261	PYRE_YEAST Orotate phosphoribosyltransferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=URA5 PE=1 SV=2
17	P0A7E3	1.07e-19	89.7	213	0.115	0.258	PYRE_ECOLI Orotate phosphoribosyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=pyrE PE=1 SV=2
18	A0A1D8PS11	1.12e-17	84.0	218	0.125	0.275	A0A1D8PS11_CANAL orotate phosphoribosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=URA5 PE=3 SV=1
19	P0CB78	1.60e-17	83.2	210	0.096	0.219	PYRE_STRPN Orotate phosphoribosyltransferase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=pyrE PE=1 SV=1
20	P50587	2.82e-16	79.7	213	0.104	0.235	PYRE_PSEAE Orotate phosphoribosyltransferase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=pyrE PE=3 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00215 OMPdecase	9.2e-75	262.6	Orotidine 5'-phosphate decarboxylase / HUMPS family
2	PF00156 Pribosyltran	2.6e-08	44.9	Phosphoribosyl transferase domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000232607

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000219240	0.995	Dihydroorotate dehydrogenase (quinone), mitochondrial
2	9606.ENSP00000362481	0.989	Uracil phosphoribosyltransferase homolog
3	9606.ENSP00000359211	0.986	Dihydropyrimidine dehydrogenase [NADP(+)]
4	9606.ENSP00000330032	0.980	Uridine phosphorylase 1
5	9606.ENSP00000356853	0.980	Uridine-cytidine kinase 2
6	9606.ENSP00000346155	0.978	Uridine-cytidine kinase-like 1
7	9606.ENSP00000474090	0.971	Uridine phosphorylase 2
8	9606.ENSP00000361285	0.969	Uridine-cytidine kinase 1
9	9606.ENSP00000379038	0.968	Thymidine phosphorylase
10	9606.ENSP00000360939	0.963	UMP-CMP kinase
11	9606.ENSP00000256722	0.955	UMP-CMP kinase 2, mitochondrial
12	9606.ENSP00000264705	0.952	CAD protein
13	9606.ENSP00000360561	0.952	Ectonucleoside triphosphate diphosphohydrolase 8
14	9606.ENSP00000361512	0.949	Ribose-phosphate pyrophosphokinase 1
15	9606.ENSP00000424595	0.948	Ribose-phosphate pyrophosphokinase 3
16	9606.ENSP00000484415	0.946	Cytosolic 5'-nucleotidase 3A
17	9606.ENSP00000245552	0.939	5'(3')-deoxyribonucleotidase, cytosolic type
18	9606.ENSP00000257770	0.937	5'-nucleotidase
19	9606.ENSP00000339479	0.929	Cytosolic purine 5'-nucleotidase
20	9606.ENSP00000360250	0.929	Ectonucleoside triphosphate diphosphohydrolase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004590	1.000	orotidine-5'-phosphate decarboxylase activity
GO:0004588	1.000	orotate phosphoribosyltransferase activity
GO:0005488	0.975	binding
GO:0005515	0.973	protein binding
GO:0042802	0.859	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0055086	0.997	nucleobase-containing small molecule metabolic process
GO:0072528	0.997	pyrimidine-containing compound biosynthetic process
GO:0009123	0.990	nucleoside monophosphate metabolic process
GO:0009117	0.973	nucleotide metabolic process
GO:0009129	0.969	pyrimidine nucleoside monophosphate metabolic process
GO:1901293	0.965	nucleoside phosphate biosynthetic process
GO:1901135	0.964	carbohydrate derivative metabolic process
GO:0009165	0.964	nucleotide biosynthetic process
GO:0009124	0.960	nucleoside monophosphate biosynthetic process
GO:0009218	0.954	pyrimidine ribonucleotide metabolic process
GO:0006221	0.951	pyrimidine nucleotide biosynthetic process
GO:1901137	0.945	carbohydrate derivative biosynthetic process
GO:0009156	0.941	ribonucleoside monophosphate biosynthetic process
GO:0009260	0.936	ribonucleotide biosynthetic process
GO:0009220	0.343	pyrimidine ribonucleotide biosynthetic process
GO:0065007	0.314	biological regulation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0005634	0.995	nucleus
GO:0070013	0.630	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:11596	1.000	H(+) + orotidine 5'-phosphate = CO2 + UMP
RHEA:10380	1.000	diphosphate + orotidine 5'-phosphate = 5-phospho-alpha-D-ribose 1-diphosphate + orotate
EC:4.1.1.23	1.000	orotidine-5'-phosphate decarboxylase.
EC:2.4.2.10	1.000	orotate phosphoribosyltransferase.

[back to server]