StarFunc result for job id P11177

User Input

>input (359 residues)
MAAVSGLVRRPLREVSGLLKRRFHWTAPAALQVTVRDAINQGMDEELERDEKVFLLGEEV
AQYDGAYKVSRGLWKKYGDKRIIDTPISEMGFAGIAVGAAMAGLRPICEFMTFNFSMQAI
DQVINSAAKTYYMSGGLQPVPIVFRGPNGASAGVAAQHSQCFAAWYGHCPGLKVVSPWNS
EDAKGLIKSAIRDNNPVVVLENELMYGVPFEFPPEAQSKDFLIPIGKAKIERQGTHITVV
SHSRPVGHCLEAAAVLSKEGVECEVINMRTIRPMDMETIEASVMKTNHLVTVEGGWPQFG
VGAEICARIMEGPAFNFLDAPAVRVTGADVPMPYAKILEDNSIPQVKDIIFAIKKTLNI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A384MDR8	0.962	0.962	2.167E-79	359	1.000	1.000	A0A384MDR8.pdb.gz	A0A384MDR8_HUMAN Pyruvate dehydrogenase E1 component subunit beta OS=Homo sapiens OX=9606 PE=2 SV=1
2	AFDB:Q7T368	0.930	0.930	1.093E-72	359	0.838	0.838	Q7T368.pdb.gz	Q7T368_DANRE Pyruvate dehydrogenase E1 component subunit beta OS=Danio rerio OX=7955 GN=wu:fc76a05 PE=1 SV=1
3	PDB:6cerD	0.920	0.998	4.956E-70	331	0.916	0.994	6cerD.pdb.gz	Pyruvate dehydrogenase complex deficiency is linked to regulatory loop disorder in the alpha V138M variant of human pyruvate dehydrogenase.
4	AFDB:Q7K5K3	0.918	0.903	1.956E-63	365	0.657	0.647	Q7K5K3.pdb.gz	ODPB_DROME Pyruvate dehydrogenase E1 component subunit beta, mitochondrial OS=Drosophila melanogaster OX=7227 GN=Pdhb PE=1 SV=1
5	AFDB:O44451	0.924	0.943	5.139E-62	352	0.643	0.656	O44451.pdb.gz	ODPB_CAEEL Pyruvate dehydrogenase E1 component subunit beta, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=pdhb-1 PE=1 SV=2
6	AFDB:C9J634	0.788	0.808	9.365E-60	350	0.794	0.814	C9J634.pdb.gz	C9J634_HUMAN Pyruvate dehydrogenase E1 component subunit beta OS=Homo sapiens OX=9606 GN=PDHB PE=1 SV=1
7	AFDB:Q09171	0.923	0.905	3.547E-59	366	0.588	0.577	Q09171.pdb.gz	ODPB_SCHPO Pyruvate dehydrogenase E1 component subunit beta, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pdb1 PE=1 SV=1
8	AFDB:Q57ZD2	0.914	0.943	9.924E-59	348	0.563	0.580	Q57ZD2.pdb.gz	Q57ZD2_TRYB2 Pyruvate dehydrogenase E1 component subunit beta OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.30P12.440 PE=4 SV=1
9	AFDB:Q6FMM4	0.920	0.922	1.054E-58	358	0.552	0.553	Q6FMM4.pdb.gz	Q6FMM4_CANGA Pyruvate dehydrogenase E1 component subunit beta OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CAGL0K06831g PE=4 SV=1
10	AFDB:P32473	0.915	0.898	4.788E-58	366	0.582	0.571	P32473.pdb.gz	ODPB_YEAST Pyruvate dehydrogenase E1 component subunit beta, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PDB1 PE=1 SV=2
11	AFDB:Q38799	0.917	0.907	6.884E-58	363	0.577	0.570	Q38799.pdb.gz	ODPB1_ARATH Pyruvate dehydrogenase E1 component subunit beta-1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=PDH2 PE=1 SV=2
12	PDB:1umbD	0.877	0.974	1.211E-40	323	0.354	0.393	1umbD.pdb.gz	Ligand-induced Conformational Changes and a Reaction Intermediate in Branched-chain 2-Oxo Acid Dehydrogenase (E1) from Thermus thermophilus HB8, as Revealed by X-ray Crystallography
13	PDB:3dufD	0.878	0.971	1.630E-38	324	0.348	0.386	3dufD.pdb.gz	Snapshots of catalysis in the e1 subunit of the pyruvate dehydrogenase multienzyme complex
14	PDB:6rjbB	0.736	0.440	1.146E-19	622	0.164	0.095	6rjbB.pdb.gz	Low-barrier hydrogen bonds in enzyme cooperativity.
15	PDB:2o1sB	0.745	0.552	4.612E-19	493	0.164	0.120	2o1sB.pdb.gz	Crystal Structure of 1-Deoxy-D-xylulose 5-Phosphate Synthase, a Crucial Enzyme for Isoprenoids Biosynthesis.
16	PDB:2o1sA	0.682	0.467	3.399E-18	536	0.164	0.110	2o1sA.pdb.gz	Crystal Structure of 1-Deoxy-D-xylulose 5-Phosphate Synthase, a Crucial Enzyme for Isoprenoids Biosynthesis.
17	PDB:7bzy11	0.679	0.434	1.284E-16	584	0.201	0.123	7bzy11.pdb.gz
18	PDB:5hhtB	0.650	0.367	1.619E-12	667	0.145	0.078	5hhtB.pdb.gz	Structural Analysis of an Evolved Transketolase Reveals Divergent Binding Modes.
19	PDB:1ay0A	0.626	0.351	3.346E-12	678	0.128	0.068	1ay0A.pdb.gz	Identification of catalytically important residues in yeast transketolase.
20	PDB:1itzA	0.636	0.364	3.346E-12	666	0.148	0.080	1itzA.pdb.gz	Structure and properties of an engineered transketolase from maize

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A384MDR8	0.0	743	359	1.000	1.000	A0A384MDR8_HUMAN Pyruvate dehydrogenase E1 component subunit beta OS=Homo sapiens OX=9606 PE=2 SV=1
2	C9J634	0.0	600	350	0.819	0.840	C9J634_HUMAN Pyruvate dehydrogenase E1 component subunit beta OS=Homo sapiens OX=9606 GN=PDHB PE=1 SV=1
3	P11177	0.0	743	359	1.000	1.000	ODPB_HUMAN Pyruvate dehydrogenase E1 component subunit beta, mitochondrial OS=Homo sapiens OX=9606 GN=PDHB PE=1 SV=3
4	P49432	0.0	707	359	0.944	0.944	ODPB_RAT Pyruvate dehydrogenase E1 component subunit beta, mitochondrial OS=Rattus norvegicus OX=10116 GN=Pdhb PE=1 SV=2
5	Q7T368	0.0	642	359	0.838	0.838	Q7T368_DANRE Pyruvate dehydrogenase E1 component subunit beta OS=Danio rerio OX=7955 GN=wu:fc76a05 PE=1 SV=1
6	Q9D051	0.0	706	359	0.936	0.936	ODPB_MOUSE Pyruvate dehydrogenase E1 component subunit beta, mitochondrial OS=Mus musculus OX=10090 GN=Pdhb PE=1 SV=1
7	Q7K5K3	1.94e-175	493	365	0.660	0.649	ODPB_DROME Pyruvate dehydrogenase E1 component subunit beta, mitochondrial OS=Drosophila melanogaster OX=7227 GN=Pdhb PE=1 SV=1
8	O44451	4.82e-174	489	352	0.643	0.656	ODPB_CAEEL Pyruvate dehydrogenase E1 component subunit beta, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=pdhb-1 PE=1 SV=2
9	Q09171	2.98e-153	437	366	0.585	0.574	ODPB_SCHPO Pyruvate dehydrogenase E1 component subunit beta, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pdb1 PE=1 SV=1
10	C8VRK6	1.49e-151	433	375	0.599	0.573	C8VRK6_EMENI Pyruvate dehydrogenase E1 component subunit beta OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_09403 PE=4 SV=1
11	P32473	3.03e-151	432	366	0.568	0.557	ODPB_YEAST Pyruvate dehydrogenase E1 component subunit beta, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PDB1 PE=1 SV=2
12	Q9ZQY2	1.20e-149	428	374	0.579	0.556	Q9ZQY2_MAIZE Pyruvate dehydrogenase E1 component subunit beta OS=Zea mays OX=4577 GN=542483 PE=2 SV=1
13	Q57ZD2	7.69e-149	425	348	0.579	0.598	Q57ZD2_TRYB2 Pyruvate dehydrogenase E1 component subunit beta OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.30P12.440 PE=4 SV=1
14	Q38799	1.18e-148	425	363	0.577	0.570	ODPB1_ARATH Pyruvate dehydrogenase E1 component subunit beta-1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=PDH2 PE=1 SV=2
15	Q6FMM4	1.10e-146	420	358	0.560	0.561	Q6FMM4_CANGA Pyruvate dehydrogenase E1 component subunit beta OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CAGL0K06831g PE=4 SV=1
16	Q9C6Z3	4.62e-81	254	406	0.348	0.308	ODPB2_ARATH Pyruvate dehydrogenase E1 component subunit beta-2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PDH-E1 BETA PE=1 SV=1
17	O64688	1.16e-79	251	406	0.343	0.303	ODPB3_ARATH Pyruvate dehydrogenase E1 component subunit beta-3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=E1-BETA-2 PE=1 SV=1
18	P21874	1.55e-72	230	325	0.345	0.382	ODPB_GEOSE Pyruvate dehydrogenase E1 component subunit beta OS=Geobacillus stearothermophilus OX=1422 GN=pdhB PE=1 SV=2
19	Q5SLR3	3.19e-70	224	324	0.357	0.395	ODBB_THET8 2-oxoisovalerate dehydrogenase subunit beta OS=Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) OX=300852 GN=TTHA0230 PE=1 SV=1
20	Q8IL09	9.03e-67	218	415	0.315	0.272	Q8IL09_PLAF7 Pyruvate dehydrogenase E1 component subunit beta OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1446400 PE=4 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02780 Transketolase_C	9e-35	130.7	Transketolase, C-terminal domain
2	PF02779 Transket_pyr	3.3e-43	158.9	Transketolase, pyrimidine binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 60711.ENSCSAP00000008343

Rank	PPI partner	STRING score	Description
1	60711.ENSCSAP00000001741	0.999	Pyruvate dehydrogenase complex, component X
2	60711.ENSCSAP00000007519	0.999	Dihydrolipoamide dehydrogenase
3	60711.ENSCSAP00000015216	0.999	The pyruvate dehydrogenase complex catalyzes the overall conversion of pyruvate to acetyl-CoA and CO(2).
4	60711.ENSCSAP00000017595	0.999	The pyruvate dehydrogenase complex catalyzes the overall conversion of pyruvate to acetyl-CoA and CO(2).
5	60711.ENSCSAP00000012133	0.998	The pyruvate dehydrogenase complex catalyzes the overall conversion of pyruvate to acetyl-CoA and CO(2).
6	60711.ENSCSAP00000014529	0.996	The branched-chain alpha-keto dehydrogenase complex catalyzes the overall conversion of alpha-keto acids to acyl-CoA and CO(2). It contains multiple copies of three enzymatic components: branched-chain alpha-keto acid decarboxylase (E1), lipoamide acyltransferase (E2) and lipoamide dehydrogenase (E3)
7	60711.ENSCSAP00000018170	0.991	Belongs to the pyruvate kinase family.
8	60711.ENSCSAP00000001504	0.988	Citrate synthase
9	60711.ENSCSAP00000010848	0.987	Pyruvate dehydrogenase kinase, isozyme 1
10	60711.ENSCSAP00000006907	0.982	Transaldolase is important for the balance of metabolites in the pentose-phosphate pathway
11	60711.ENSCSAP00000008469	0.979	Dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex)
12	60711.ENSCSAP00000009223	0.970	Transketolase
13	60711.ENSCSAP00000016518	0.961	Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex
14	60711.ENSCSAP00000004684	0.953	Catalyzes a 2-step reaction, involving the ATP-dependent carboxylation of the covalently attached biotin in the first step and the transfer of the carboxyl group to pyruvate in the second.
15	60711.ENSCSAP00000011967	0.949	Succinyl-CoA synthetase functions in the citric acid cycle (TCA), coupling the hydrolysis of succinyl-CoA to the synthesis of either ATP or GTP and thus represents the only step of substrate-level phosphorylation in the TCA. The alpha subunit of the enzyme binds the substrates coenzyme A and phosphate, while succinate binding and specificity for either ATP or GTP is provided by different beta subunits
16	60711.ENSCSAP00000013418	0.947	Malic enzyme 1, NADP(+)-dependent, cytosolic
17	60711.ENSCSAP00000014104	0.947	Malic enzyme 2, NAD(+)-dependent, mitochondrial
18	60711.ENSCSAP00000014415	0.947	Malic enzyme 3, NADP(+)-dependent, mitochondrial
19	60711.ENSCSAP00000003069	0.946	Transketolase-like 1
20	60711.ENSCSAP00000002115	0.943	Aconitate hydratase, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004738	1.000	pyruvate dehydrogenase activity
GO:0016624	0.998	oxidoreductase activity, acting on the aldehyde or oxo group of donors, disulfide as acceptor
GO:0005488	0.989	binding
GO:0005515	0.975	protein binding
GO:0004739	0.645	pyruvate dehydrogenase (acetyl-transferring) activity
GO:0016740	0.307	transferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:1901135	0.996	carbohydrate derivative metabolic process
GO:0090407	0.996	organophosphate biosynthetic process
GO:0006163	0.996	purine nucleotide metabolic process
GO:1901362	0.995	organic cyclic compound biosynthetic process
GO:0019438	0.995	aromatic compound biosynthetic process
GO:0018130	0.995	heterocycle biosynthetic process
GO:0044271	0.995	cellular nitrogen compound biosynthetic process
GO:0006164	0.990	purine nucleotide biosynthetic process
GO:0009150	0.981	purine ribonucleotide metabolic process
GO:0009152	0.967	purine ribonucleotide biosynthetic process
GO:0006637	0.957	acyl-CoA metabolic process
GO:0006090	0.949	pyruvate metabolic process
GO:0034033	0.926	purine nucleoside bisphosphate biosynthetic process
GO:0034030	0.925	ribonucleoside bisphosphate biosynthetic process
GO:0006085	0.917	acetyl-CoA biosynthetic process
GO:0006091	0.440	generation of precursor metabolites and energy

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0070013	0.998	intracellular organelle lumen
GO:0031981	0.993	nuclear lumen
GO:0032991	0.992	protein-containing complex
GO:0098798	0.908	mitochondrial protein-containing complex
GO:1902494	0.882	catalytic complex
GO:0005759	0.876	mitochondrial matrix
GO:1990204	0.796	oxidoreductase complex
GO:0005654	0.647	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.2.4.-	0.998	With a disulfide as acceptor.
RHEA:19189	0.645	(R)-N(6)-lipoyl-L-lysyl-[dihydrolipoyllysine-residue acetyltransferase] + H(+) + pyruvate = (R)-N(6)-(S(8)-acetyldihydrolipoyl)-L-lysyl-[dihydrolipoyllysine-residue acetyltransferase] + CO2
EC:1.2.4.1	0.645	pyruvate dehydrogenase (acetyl-transferring).
EC:2.-.-.-	0.307	Transferases.

[back to server]