StarFunc result for job id P11182

User Input

>input (482 residues)
MAAVRMLRTWSRNAGKLICVRYFQTCGNVHVLKPNYVCFFGYPSFKYSHPHHFLKTTAAL
RGQVVQFKLSDIGEGIREVTVKEWYVKEGDTVSQFDSICEVQSDKASVTITSRYDGVIKK
LYYNLDDIAYVGKPLVDIETEALKDSEEDVVETPAVSHDEHTHQEIKGRKTLATPAVRRL
AMENNIKLSEVVGSGKDGRILKEDILNYLEKQTGAILPPSPKVEIMPPPPKPKDMTVPIL
VSKPPVFTGKDKTEPIKGFQKAMVKTMSAALKIPHFGYCDEIDLTELVKLREELKPIAFA
RGIKLSFMPFFLKAASLGLLQFPILNASVDENCQNITYKASHNIGIAMDTEQGLIVPNVK
NVQICSIFDIATELNRLQKLGSVGQLSTTDLTGGTFTLSNIGSIGGTFAKPVIMPPEVAI
GALGSIKAIPRFNQKGEVYKAQIMNVSWSADHRVIDGATMSRFSNLWKSYLENPAFMLLD
LK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P11182	1.000	1.000	6.820E-96	482	1.000	1.000	P11182.pdb.gz	ODB2_HUMAN Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial OS=Homo sapiens OX=9606 GN=DBT PE=1 SV=3
2	AFDB:P53395	0.502	0.502	8.430E-89	482	0.880	0.880	P53395.pdb.gz	ODB2_MOUSE Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial OS=Mus musculus OX=10090 GN=Dbt PE=1 SV=2
3	AFDB:Q5BKV3	0.489	0.478	6.119E-76	493	0.705	0.690	Q5BKV3.pdb.gz	Q5BKV3_DANRE Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex OS=Danio rerio OX=7955 GN=zgc:103768 PE=1 SV=1
4	AFDB:Q23571	0.483	0.519	1.522E-61	448	0.496	0.533	Q23571.pdb.gz	ODB2_CAEEL Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=dbt-1 PE=2 SV=1
5	AFDB:Q9VXY3	0.482	0.502	1.993E-59	462	0.467	0.487	Q9VXY3.pdb.gz	Q9VXY3_DROME Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex OS=Drosophila melanogaster OX=7227 GN=Dbct PE=1 SV=1
6	AFDB:Q9M7Z1	0.480	0.479	1.456E-55	483	0.376	0.375	Q9M7Z1.pdb.gz	ODB2_ARATH Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=BCE2 PE=1 SV=1
7	AFDB:Q57Z16	0.478	0.524	1.000E-51	439	0.371	0.408	Q57Z16.pdb.gz	Q57Z16_TRYB2 Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.45E22.630 PE=3 SV=1
8	AFDB:P11961	0.471	0.530	8.468E-46	428	0.320	0.360	P11961.pdb.gz	ODP2_GEOSE Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Geobacillus stearothermophilus OX=1422 GN=pdhC PE=1 SV=3
9	AFDB:P9WIS7	0.457	0.401	3.124E-43	553	0.297	0.259	P9WIS7.pdb.gz	ODP2_MYCTU Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=dlaT PE=1 SV=1
10	AFDB:O00330	0.453	0.437	1.057E-42	501	0.270	0.259	O00330.pdb.gz	ODPX_HUMAN Pyruvate dehydrogenase protein X component, mitochondrial OS=Homo sapiens OX=9606 GN=PDHX PE=1 SV=3
11	PDB:7b9kA	0.466	0.697	1.998E-31	320	0.228	0.344	7b9kA.pdb.gz
12	PDB:6h60A	0.445	0.894	4.954E-22	233	0.137	0.283	6h60A.pdb.gz
13	PDB:6h55A	0.443	0.887	5.333E-21	233	0.156	0.322	6h55A.pdb.gz
14	PDB:3bg5B	0.135	0.062	1.428E-5	1074	0.046	0.020	3bg5B.pdb.gz	Crystal structures of human and Staphylococcus aureus pyruvate carboxylase and molecular insights into the carboxyltransfer reaction.
15	PDB:4hnvB	0.135	0.064	2.188E-5	1033	0.046	0.021	4hnvB.pdb.gz	Characterizing the Importance of the Biotin Carboxylase Domain Dimer for Staphylococcus aureus Pyruvate Carboxylase Catalysis.
16	PDB:5ja2A	0.223	0.100	2.325E-5	1238	0.068	0.027	5ja2A.pdb.gz	Structures of a Nonribosomal Peptide Synthetase Module Bound to MbtH-like Proteins Support a Highly Dynamic Domain Architecture.
17	PDB:3bg5A	0.134	0.059	4.545E-5	1137	0.046	0.019	3bg5A.pdb.gz	Crystal structures of human and Staphylococcus aureus pyruvate carboxylase and molecular insights into the carboxyltransfer reaction.
18	PDB:4hr7B	0.132	0.703	4.332E-4	80	0.035	0.212	4hr7B.pdb.gz
19	PDB:3n6rA	0.135	0.111	5.875E-4	591	0.021	0.017	3n6rA.pdb.gz	Crystal structure of the alpha(6)beta(6) holoenzyme of propionyl-coenzyme A carboxylase.
20	PDB:6g2dC	0.138	0.033	6.244E-4	2121	0.039	0.009	6g2dC.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P11182	0.0	999	482	1.000	1.000	ODB2_HUMAN Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial OS=Homo sapiens OX=9606 GN=DBT PE=1 SV=3
2	P53395	0.0	889	482	0.880	0.880	ODB2_MOUSE Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial OS=Mus musculus OX=10090 GN=Dbt PE=1 SV=2
3	Q5BKV3	0.0	663	493	0.707	0.692	Q5BKV3_DANRE Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex OS=Danio rerio OX=7955 GN=zgc:103768 PE=1 SV=1
4	Q5VVL7	0.0	650	320	0.649	0.978	Q5VVL7_HUMAN Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex OS=Homo sapiens OX=9606 GN=DBT PE=1 SV=1
5	Q23571	8.45e-161	464	448	0.485	0.522	ODB2_CAEEL Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=dbt-1 PE=2 SV=1
6	Q9VXY3	5.83e-145	425	462	0.471	0.491	Q9VXY3_DROME Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex OS=Drosophila melanogaster OX=7227 GN=Dbct PE=1 SV=1
7	Q9M7Z1	1.64e-107	330	483	0.359	0.358	ODB2_ARATH Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=BCE2 PE=1 SV=1
8	Q57Z16	5.04e-105	322	439	0.371	0.408	Q57Z16_TRYB2 Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.45E22.630 PE=3 SV=1
9	P11961	3.71e-70	231	428	0.307	0.346	ODP2_GEOSE Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Geobacillus stearothermophilus OX=1422 GN=pdhC PE=1 SV=3
10	O97227	1.03e-60	207	448	0.295	0.317	O97227_PLAF7 Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0303700 PE=3 SV=1
11	Q9HIA5	1.52e-57	197	400	0.299	0.360	Q9HIA5_THEAC Probable lipoamide acyltransferase OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) OX=273075 GN=Ta1436 PE=1 SV=1
12	P06959	3.53e-46	172	630	0.274	0.210	ODP2_ECOLI Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Escherichia coli (strain K12) OX=83333 GN=aceF PE=1 SV=3
13	P0AFG6	8.40e-40	150	405	0.245	0.291	ODO2_ECOLI Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex OS=Escherichia coli (strain K12) OX=83333 GN=sucB PE=1 SV=2
14	Q5M729	2.91e-38	148	539	0.278	0.249	ODP23_ARATH Dihydrolipoyllysine-residue acetyltransferase component 3 of pyruvate dehydrogenase complex, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At1g54220 PE=1 SV=1
15	O06159	1.35e-37	144	393	0.272	0.333	BKDC_MYCTU Dihydrolipoyllysine-residue acyltransferase component of branched-chain alpha-ketoacid dehydrogenase complex OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=bkdC PE=1 SV=2
16	O00330	3.98e-37	144	501	0.259	0.250	ODPX_HUMAN Pyruvate dehydrogenase protein X component, mitochondrial OS=Homo sapiens OX=9606 GN=PDHX PE=1 SV=3
17	Q8BKZ9	4.99e-37	144	501	0.251	0.242	ODPX_MOUSE Pyruvate dehydrogenase protein X component, mitochondrial OS=Mus musculus OX=10090 GN=Pdhx PE=1 SV=1
18	H0YDD4	5.68e-37	144	520	0.257	0.238	H0YDD4_HUMAN Acetyltransferase component of pyruvate dehydrogenase complex OS=Homo sapiens OX=9606 GN=DLAT PE=1 SV=2
19	Q8IEA6	9.31e-37	142	421	0.257	0.295	Q8IEA6_PLAF7 dihydrolipoyllysine-residue succinyltransferase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1320800 PE=3 SV=1
20	Q8BMF4	8.13e-36	142	642	0.251	0.188	ODP2_MOUSE Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial OS=Mus musculus OX=10090 GN=Dlat PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00198 2-oxoacid_dh	4e-77	270.4	2-oxoacid dehydrogenases acyltransferase (catalytic domain)
2	PF00364 Biotin_lipoyl	3.8e-17	73.2	Biotin-requiring enzyme
3	PF13533 Biotin_lipoyl_2	11	17.2	Biotin-lipoyl like
4	PF02817 E3_binding	2.3e-12	58.3	e3 binding domain
5	PF16576 HlyD_D23	1.5e+02	13.0	Barrel-sandwich domain of CusB or HlyD membrane-fusion
6	PF05440 MtrB	3.4e+02	13.0	Tetrahydromethanopterin S-methyltransferase subunit B

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000359151

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000205402	0.997	Dihydrolipoyl dehydrogenase, mitochondrial
2	9606.ENSP00000318351	0.997	2-oxoisovalerate dehydrogenase subunit beta, mitochondrial
3	9606.ENSP00000269980	0.995	2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial
4	9606.ENSP00000477341	0.977	Protein phosphatase 1K, mitochondrial
5	9606.ENSP00000418397	0.976	Isovaleryl-CoA dehydrogenase, mitochondrial
6	9606.ENSP00000365462	0.973	This is one of the 2 subunits of the biotin-dependent propionyl-CoA carboxylase (PCC), a mitochondrial enzyme involved in the catabolism of odd chain fatty acids, branched-chain amino acids isoleucine, threonine, methionine, and valine and other metabolites . Propionyl-CoA carboxylase catalyzes the carboxylation of propionyl-CoA/propanoyl-CoA to D-methylmalonyl- CoA/(S)-methylmalonyl-CoA (PubMed:8434582, PubMed:6765947, PubMed:10101253). Within the holoenzyme, the alpha subunit catalyzes the ATP-dependent carboxylation of the biotin carried by the biotin carboxyl carrier (BCC) domain, [...]
7	9606.ENSP00000222673	0.963	2-oxoglutarate dehydrogenase, mitochondrial
8	9606.ENSP00000322991	0.963	Branched-chain-amino-acid aminotransferase, mitochondrial
9	9606.ENSP00000377115	0.963	Lipoyltransferase 1, mitochondrial
10	9606.ENSP00000419027	0.959	This is one of the 2 subunits of the biotin-dependent propionyl-CoA carboxylase (PCC), a mitochondrial enzyme involved in the catabolism of odd chain fatty acids, branched-chain amino acids isoleucine, threonine, methionine, and valine and other metabolites . Propionyl-CoA carboxylase catalyzes the carboxylation of propionyl-CoA/propanoyl-CoA to D-methylmalonyl- CoA/(S)-methylmalonyl-CoA . Within the holoenzyme, the alpha subunit catalyzes the ATP-dependent carboxylation of the biotin carried by the biotin carboxyl carrier (BCC) domain, while the beta subunit then transfers the carboxy [...]
11	9606.ENSP00000450436	0.956	Methylmalonate-semialdehyde dehydrogenase [acylating], mitochondrial
12	9606.ENSP00000319531	0.947	Glycine cleavage system H protein, mitochondrial
13	9606.ENSP00000443459	0.947	Branched-chain-amino-acid aminotransferase, cytosolic
14	9606.ENSP00000378405	0.937	[3-methyl-2-oxobutanoate dehydrogenase [lipoamide]] kinase, mitochondrial
15	9606.ENSP00000281182	0.925	Isobutyryl-CoA dehydrogenase, mitochondrial
16	9606.ENSP00000265395	0.924	3-hydroxyisobutyrate dehydrogenase, mitochondrial
17	9606.ENSP00000436585	0.923	Ethylmalonyl-CoA decarboxylase
18	9606.ENSP00000348775	0.921	Peroxisomal acyl-coenzyme A oxidase 3
19	9606.ENSP00000316924	0.912	Acetyl-coenzyme A synthetase 2-like, mitochondrial
20	9606.ENSP00000253382	0.910	Acetyl-coenzyme A synthetase, cytoplasmic

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0031625	0.998	ubiquitin protein ligase binding
GO:0003824	0.980	catalytic activity
GO:0016746	0.587	acyltransferase activity
GO:0016747	0.556	acyltransferase activity, transferring groups other than amino-acyl groups
GO:0140096	0.440	catalytic activity, acting on a protein
GO:0016407	0.305	acetyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.995	organic substance metabolic process
GO:0044237	0.995	cellular metabolic process
GO:0009081	0.993	branched-chain amino acid metabolic process
GO:0009063	0.857	amino acid catabolic process
GO:0009083	0.741	branched-chain amino acid catabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0070013	0.983	intracellular organelle lumen
GO:0032991	0.952	protein-containing complex
GO:0005829	0.923	cytosol
GO:0043232	0.891	intracellular non-membrane-bounded organelle
GO:1902494	0.826	catalytic complex
GO:0005759	0.796	mitochondrial matrix
GO:0098798	0.579	mitochondrial protein-containing complex
GO:1990204	0.566	oxidoreductase complex
GO:0031981	0.400	nuclear lumen
GO:0015630	0.364	microtubule cytoskeleton
GO:0005654	0.316	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.3.-.-	0.587	Acyltransferases.
EC:2.3.1.-	0.556	Transferring groups other than amino-acyl groups.

[back to server]