StarFunc result for job id P11215

User Input

>input (1152 residues)
MALRVLLLTALTLCHGFNLDTENAMTFQENARGFGQSVVQLQGSRVVVGAPQEIVAANQR
GSLYQCDYSTGSCEPIRLQVPVEAVNMSLGLSLAATTSPPQLLACGPTVHQTCSENTYVK
GLCFLFGSNLRQQPQKFPEALRGCPQEDSDIAFLIDGSGSIIPHDFRRMKEFVSTVMEQL
KKSKTLFSLMQYSEEFRIHFTFKEFQNNPNPRSLVKPITQLLGRTHTATGIRKVVRELFN
ITNGARKNAFKILVVITDGEKFGDPLGYEDVIPEADREGVIRYVIGVGDAFRSEKSRQEL
NTIASKPPRDHVFQVNNFEALKTIQNQLREKIFAIEGTQTGSSSSFEHEMSQEGFSAAIT
SNGPLLSTVGSYDWAGGVFLYTSKEKSTFINMTRVDSDMNDAYLGYAAAIILRNRVQSLV
LGAPRYQHIGLVAMFRQNTGMWESNANVKGTQIGAYFGASLCSVDVDSNGSTDLVLIGAP
HYYEQTRGGQVSVCPLPRGRARWQCDAVLYGEQGQPWGRFGAALTVLGDVNGDKLTDVAI
GAPGEEDNRGAVYLFHGTSGSGISPSHSQRIAGSKLSPRLQYFGQSLSGGQDLTMDGLVD
LTVGAQGHVLLLRSQPVLRVKAIMEFNPREVARNVFECNDQVVKGKEAGEVRVCLHVQKS
TRDRLREGQIQSVVTYDLALDSGRPHSRAVFNETKNSTRRQTQVLGLTQTCETLKLQLPN
CIEDPVSPIVLRLNFSLVGTPLSAFGNLRPVLAEDAQRLFTALFPFEKNCGNDNICQDDL
SITFSFMSLDCLVVGGPREFNVTVTVRNDGEDSYRTQVTFFFPLDLSYRKVSTLQNQRSQ
RSWRLACESASSTEVSGALKSTSCSINHPIFPENSEVTFNITFDVDSKASLGNKLLLKAN
VTSENNMPRTNKTEFQLELPVKYAVYMVVTSHGVSTKYLNFTASENTSRVMQHQYQVSNL
GQRSLPISLVFLVPVRLNQTVIWDRPQVTFSENLSSTCHTKERLPSHSDFLAELRKAPVV
NCSIAVCQRIQCDIPFFGIQEEFNATLKGNLSFDWYIKTSHNHLLIVSTAEILFNDSVFT
LLPGQGAFVRSQTETKVEPFEVPNPLPLIVGSSVGGLLLLALITAALYKLGFFKRQYKDM
MSEGGPPGAEPQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:3k6sC	0.467	0.601	0.000	885	0.470	0.612	3k6sC.pdb.gz	Structure of an integrin with an alphaI domain, complement receptor type 4.
2	PDB:4nehA	0.506	0.537	0.000	1084	0.569	0.605	4nehA.pdb.gz	An internal ligand-bound, metastable state of a leukocyte integrin, alpha X beta 2.
3	PDB:4nenA	0.492	0.532	0.000	1063	0.556	0.603	4nenA.pdb.gz	An internal ligand-bound, metastable state of a leukocyte integrin, alpha X beta 2.
4	PDB:7uslA	0.486	0.649	0.000	856	0.736	0.991	7uslA.pdb.gz	Structural basis for non-canonical integrin engagement by Bordetella adenylate cyclase toxin.
5	AFDB:A0A0G2K4L8	0.517	0.513	0.000	1161	0.663	0.658	A0A0G2K4L8.pdb.gz	A0A0G2K4L8_RAT Integrin subunit alpha M OS=Rattus norvegicus OX=10116 GN=Itgam PE=3 SV=2
6	AFDB:F1LP44	0.502	0.498	0.000	1161	0.352	0.349	F1LP44.pdb.gz	F1LP44_RAT Integrin subunit alpha L OS=Rattus norvegicus OX=10116 GN=Itgal PE=1 SV=3
7	AFDB:P05555	0.527	0.527	0.000	1153	0.745	0.744	P05555.pdb.gz	ITAM_MOUSE Integrin alpha-M OS=Mus musculus OX=10090 GN=Itgam PE=1 SV=2
8	AFDB:P11215	1.000	1.000	0.000	1152	1.000	1.000	P11215.pdb.gz	ITAM_HUMAN Integrin alpha-M OS=Homo sapiens OX=9606 GN=ITGAM PE=1 SV=2
9	AFDB:P20701	0.499	0.492	0.000	1170	0.330	0.325	P20701.pdb.gz	ITAL_HUMAN Integrin alpha-L OS=Homo sapiens OX=9606 GN=ITGAL PE=1 SV=3
10	AFDB:P20702	0.517	0.513	0.000	1163	0.609	0.604	P20702.pdb.gz	ITAX_HUMAN Integrin alpha-X OS=Homo sapiens OX=9606 GN=ITGAX PE=1 SV=3
11	AFDB:P24063	0.497	0.492	0.000	1163	0.340	0.337	P24063.pdb.gz	ITAL_MOUSE Integrin alpha-L OS=Mus musculus OX=10090 GN=Itgal PE=1 SV=3
12	AFDB:P61625	0.499	0.494	0.000	1165	0.340	0.336	P61625.pdb.gz	ITAL_BOVIN Integrin alpha-L OS=Bos taurus OX=9913 GN=ITGAL PE=1 SV=1
13	AFDB:Q13349	0.781	0.775	0.000	1161	0.589	0.584	Q13349.pdb.gz	ITAD_HUMAN Integrin alpha-D OS=Homo sapiens OX=9606 GN=ITGAD PE=1 SV=2
14	AFDB:Q3V0T4	0.525	0.518	0.000	1168	0.565	0.557	Q3V0T4.pdb.gz	ITAD_MOUSE Integrin alpha-D OS=Mus musculus OX=10090 GN=Itgad PE=1 SV=1
15	PDB:3fcsA	0.417	0.518	2.985E-58	913	0.178	0.225	3fcsA.pdb.gz	Structure of a complete integrin ectodomain in a physiologic resting state and activation and deactivation by applied forces.
16	PDB:4g1eA	0.416	0.490	4.287E-58	964	0.188	0.224	4g1eA.pdb.gz	AlphaV Beta3 Integrin Crystal Structures and their Functional Implications
17	PDB:7nxdA	0.444	0.550	4.273E-56	905	0.192	0.244	7nxdA.pdb.gz	Structural insights into integrin alpha 5 beta 1 opening by fibronectin ligand.
18	PDB:7sqcO0	0.123	0.124	4.042E-9	1140	0.050	0.051	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
19	PDB:7eebE	0.099	0.106	2.469E-8	1053	0.074	0.081	7eebE.pdb.gz	Structure of a mammalian sperm cation channel complex.
20	PDB:5a42A	0.093	0.073	8.539E-8	1597	0.074	0.053	5a42A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2K4L8	0.0	1798	1151	0.738	0.738	A0A0G2K4L8_RAT Integrin subunit alpha M OS=Rattus norvegicus OX=10116 GN=Itgam PE=3 SV=2
2	A0A8I5Y8A4	0.0	1743	1141	0.720	0.727	A0A8I5Y8A4_RAT Integrin subunit alpha M OS=Rattus norvegicus OX=10116 GN=Itgam PE=1 SV=1
3	A0A8I5ZVY4	0.0	1572	1088	0.675	0.715	A0A8I5ZVY4_RAT Integrin subunit alpha M OS=Rattus norvegicus OX=10116 GN=Itgam PE=1 SV=1
4	A0A8I6A686	0.0	750	1034	0.312	0.348	A0A8I6A686_RAT Integrin subunit alpha M OS=Rattus norvegicus OX=10116 GN=Itgam PE=1 SV=1
5	F1LP44	0.0	573	1161	0.352	0.349	F1LP44_RAT Integrin subunit alpha L OS=Rattus norvegicus OX=10116 GN=Itgal PE=1 SV=3
6	G3V8L7	0.0	1788	1151	0.734	0.734	G3V8L7_RAT Integrin subunit alpha M OS=Rattus norvegicus OX=10116 GN=Itgam PE=3 SV=2
7	P05555	0.0	1811	1153	0.747	0.746	ITAM_MOUSE Integrin alpha-M OS=Mus musculus OX=10090 GN=Itgam PE=1 SV=2
8	P11215	0.0	2385	1152	1.000	1.000	ITAM_HUMAN Integrin alpha-M OS=Homo sapiens OX=9606 GN=ITGAM PE=1 SV=2
9	P20702	0.0	1367	1163	0.604	0.598	ITAX_HUMAN Integrin alpha-X OS=Homo sapiens OX=9606 GN=ITGAX PE=1 SV=3
10	P61625	0.0	575	1165	0.354	0.350	ITAL_BOVIN Integrin alpha-L OS=Bos taurus OX=9913 GN=ITGAL PE=1 SV=1
11	Q13349	0.0	1354	1161	0.593	0.588	ITAD_HUMAN Integrin alpha-D OS=Homo sapiens OX=9606 GN=ITGAD PE=1 SV=2
12	Q3T1L6	0.0	568	1160	0.352	0.349	Q3T1L6_RAT Integrin alpha L OS=Rattus norvegicus OX=10116 GN=Itgal PE=2 SV=1
13	Q3V0T4	0.0	1289	1168	0.569	0.562	ITAD_MOUSE Integrin alpha-D OS=Mus musculus OX=10090 GN=Itgad PE=1 SV=1
14	Q9JI30	0.0	1787	1151	0.735	0.736	Q9JI30_RAT Integrin beta 2 alpha subunit OS=Rattus norvegicus OX=10116 GN=Itgam PE=2 SV=1
15	Q9QXH4	0.0	1330	1169	0.569	0.561	ITAX_MOUSE Integrin alpha-X OS=Mus musculus OX=10090 GN=Itgax PE=1 SV=1
16	Q9QYE7	0.0	1288	1161	0.575	0.570	ITAD_RAT Integrin alpha-D OS=Rattus norvegicus OX=10116 GN=Itgad PE=2 SV=1
17	P24063	1.06e-180	563	1162	0.342	0.339	ITAL_MOUSE Integrin alpha-L OS=Mus musculus OX=10090 GN=Itgal PE=1 SV=3
18	P20701	2.67e-178	557	1170	0.340	0.335	ITAL_HUMAN Integrin alpha-L OS=Homo sapiens OX=9606 GN=ITGAL PE=1 SV=3
19	A0A8I5ZT41	2.02e-159	504	1079	0.260	0.277	A0A8I5ZT41_RAT Integrin subunit alpha L OS=Rattus norvegicus OX=10116 GN=Itgal PE=1 SV=1
20	Q60677	3.88e-126	417	1167	0.271	0.267	ITAE_MOUSE Integrin alpha-E OS=Mus musculus OX=10090 GN=Itgae PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01839 FG-GAP	1e-18	78.0	FG-GAP repeat
2	PF14312 FG-GAP_2	51	15.5	FG-GAP repeat
3	PF13517 FG-GAP_3	0.27	23.2	FG-GAP-like repeat
4	PF00357 Integrin_alpha	0.03	25.3	Integrin alpha cytoplasmic region
5	PF08441 Integrin_alpha2	1.6e-38	144.6	Integrin alpha
6	PF00092 VWA	3.2e-35	133.5	von Willebrand factor type A domain
7	PF13519 VWA_2	2.6e-09	49.0	von Willebrand factor type A domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000441691

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000264832	0.999	Intercellular adhesion molecule 1
2	9606.ENSP00000265709	0.999	Ankyrin-1
3	9606.ENSP00000380948	0.999	Integrin beta-2
4	9606.ENSP00000339328	0.998	Urokinase plasminogen activator surface receptor
5	9606.ENSP00000245907	0.996	Complement C3
6	9606.ENSP00000271450	0.995	Low affinity immunoglobulin gamma Fc region receptor II-a
7	9606.ENSP00000329380	0.995	Platelet glycoprotein Ib alpha chain
8	9606.ENSP00000299106	0.994	Junctional adhesion molecule C
9	9606.ENSP00000359663	0.994	CD40 ligand
10	9606.ENSP00000284240	0.991	Thy-1 membrane glycoprotein
11	9606.ENSP00000415283	0.981	Intercellular adhesion molecule 2
12	9606.ENSP00000263686	0.977	P-selectin
13	9606.ENSP00000379350	0.975	Integrin beta-1
14	9606.ENSP00000304915	0.970	Interleukin-13
15	9606.ENSP00000361405	0.969	Matrix metalloproteinase-9
16	9606.ENSP00000294728	0.968	Vascular cell adhesion protein 1
17	9606.ENSP00000398736	0.965	Protein CYR61
18	9606.ENSP00000444986	0.964	Tyrosine-protein kinase HCK
19	9606.ENSP00000227163	0.963	Transcription factor PU.1
20	9606.ENSP00000345347	0.962	High mobility group protein B1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0044877	1.000	protein-containing complex binding
GO:0005515	0.999	protein binding
GO:0038023	0.687	signaling receptor activity
GO:0005102	0.413	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.994	cellular process
GO:0048522	0.988	positive regulation of cellular process
GO:0050896	0.931	response to stimulus
GO:0019222	0.925	regulation of metabolic process
GO:0051239	0.915	regulation of multicellular organismal process
GO:0009893	0.904	positive regulation of metabolic process
GO:0007155	0.898	cell adhesion
GO:0002376	0.861	immune system process
GO:0002684	0.855	positive regulation of immune system process
GO:0051716	0.765	cellular response to stimulus
GO:0032501	0.746	multicellular organismal process
GO:0051240	0.712	positive regulation of multicellular organismal process
GO:0060255	0.707	regulation of macromolecule metabolic process
GO:0048583	0.682	regulation of response to stimulus
GO:0032502	0.643	developmental process
GO:0048856	0.618	anatomical structure development
GO:0007154	0.599	cell communication
GO:0007165	0.519	signal transduction
GO:0006950	0.486	response to stress
GO:0031323	0.477	regulation of cellular metabolic process
GO:0010604	0.471	positive regulation of macromolecule metabolic process
GO:0010468	0.465	regulation of gene expression
GO:0009605	0.443	response to external stimulus
GO:0048584	0.432	positive regulation of response to stimulus
GO:0042221	0.397	response to chemical
GO:0051171	0.376	regulation of nitrogen compound metabolic process
GO:0080090	0.342	regulation of primary metabolic process
GO:0001775	0.334	cell activation
GO:0031325	0.325	positive regulation of cellular metabolic process
GO:0048519	0.321	negative regulation of biological process
GO:0006952	0.318	defense response
GO:0010646	0.300	regulation of cell communication

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0032991	0.999	protein-containing complex
GO:0009986	0.999	cell surface
GO:0043235	0.986	receptor complex
GO:0098797	0.986	plasma membrane protein complex
GO:0008305	0.980	integrin complex
GO:0012505	0.958	endomembrane system
GO:0043227	0.936	membrane-bounded organelle
GO:0005622	0.925	intracellular anatomical structure
GO:0005737	0.912	cytoplasm
GO:0043229	0.905	intracellular organelle
GO:0043231	0.902	intracellular membrane-bounded organelle
GO:0031982	0.851	vesicle
GO:0031410	0.779	cytoplasmic vesicle
GO:0005576	0.591	extracellular region
GO:0031090	0.591	organelle membrane
GO:0098588	0.522	bounding membrane of organelle
GO:0099503	0.495	secretory vesicle
GO:0030141	0.490	secretory granule
GO:0098552	0.470	side of membrane
GO:0005634	0.454	nucleus
GO:0009897	0.375	external side of plasma membrane
GO:0030054	0.306	cell junction
GO:0005615	0.300	extracellular space

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]