StarFunc result for job id P11216

User Input

>input (843 residues)
MAKPLTDSEKRKQISVRGLAGLGDVAEVRKSFNRHLHFTLVKDRNVATPRDYFFALAHTV
RDHLVGRWIRTQQHYYERDPKRIYYLSLEFYMGRTLQNTMVNLGLQNACDEAIYQLGLDL
EELEEIEEDAGLGNGGLGRLAACFLDSMATLGLAAYGYGIRYEFGIFNQKIVNGWQVEEA
DDWLRYGNPWEKARPEYMLPVHFYGRVEHTPDGVKWLDTQVVLAMPYDTPVPGYKNNTVN
TMRLWSAKAPNDFKLQDFNVGDYIEAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFV
VAATLQDIIRRFKSSKFGCRDPVRTCFETFPDKVAIQLNDTHPALSIPELMRILVDVEKV
DWDKAWEITKKTCAYTNHTVLPEALERWPVSMFEKLLPRHLEIIYAINQRHLDHVAALFP
GDVDRLRRMSVIEEGDCKRINMAHLCVIGSHAVNGVARIHSEIVKQSVFKDFYELEPEKF
QNKTNGITPRRWLLLCNPGLADTIVEKIGEEFLTDLSQLKKLLPLVSDEVFIRDVAKVKQ
ENKLKFSAFLEKEYKVKINPSSMFDVHVKRIHEYKRQLLNCLHVVTLYNRIKRDPAKAFV
PRTVMIGGKAAPGYHMAKLIIKLVTSIGDVVNHDPVVGDRLKVIFLENYRVSLAEKVIPA
ADLSQQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGAENLFIFGLRVEDVE
ALDRKGYNAREYYDHLPELKQAVDQISSGFFSPKEPDCFKDIVNMLMHHDRFKVFADYEA
YMQCQAQVDQLYRNPKEWTKKVIRNIACSGKFSSDRTITEYAREIWGVEPSDLQIPPPNI
PRD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:1e1yA	0.951	0.986	0.000	813	0.809	0.839	1e1yA.pdb.gz	Flavopiridol Inhibits Glycogen Phosphorylase by Binding at the Inhibitor Site
2	PDB:1fa9A	0.974	0.984	0.000	834	0.810	0.819	1fa9A.pdb.gz	Activation of human liver glycogen phosphorylase by alteration of the secondary structure and packing of the catalytic core.
3	PDB:2qllA	0.940	0.983	0.000	806	0.786	0.823	2qllA.pdb.gz	Molecular recognition of the protein phosphatase 1 glycogen targeting subunit by glycogen phosphorylase.
4	PDB:3gpbA	0.950	0.961	0.000	833	0.832	0.842	3gpbA.pdb.gz	Comparison of the binding of glucose and glucose 1-phosphate derivatives to T-state glycogen phosphorylase b.
5	PDB:5ikoA	0.942	0.984	0.000	807	0.957	1.000	5ikoA.pdb.gz	Insights into Brain Glycogen Metabolism: THE STRUCTURE OF HUMAN BRAIN GLYCOGEN PHOSPHORYLASE.
6	AFDB:E1BSN7	0.970	0.970	0.000	843	0.912	0.912	E1BSN7.pdb.gz	E1BSN7_CHICK Alpha-1,4 glucan phosphorylase OS=Gallus gallus OX=9031 GN=PYGB PE=1 SV=2
7	AFDB:E7EXT3	0.997	0.998	0.000	842	0.811	0.812	E7EXT3.pdb.gz	E7EXT3_DANRE Alpha-1,4 glucan phosphorylase OS=Danio rerio OX=7955 GN=zgc:63642 PE=1 SV=1
8	AFDB:P00489	0.997	0.997	0.000	843	0.837	0.837	P00489.pdb.gz	PYGM_RABIT Glycogen phosphorylase, muscle form OS=Oryctolagus cuniculus OX=9986 GN=PYGM PE=1 SV=3
9	AFDB:P09811	0.955	0.947	0.000	850	0.817	0.811	P09811.pdb.gz	PYGL_RAT Glycogen phosphorylase, liver form OS=Rattus norvegicus OX=10116 GN=Pygl PE=1 SV=5
10	AFDB:Q503C7	0.997	0.998	0.000	842	0.800	0.800	Q503C7.pdb.gz	Q503C7_DANRE Alpha-1,4 glucan phosphorylase OS=Danio rerio OX=7955 GN=im:7150327 PE=1 SV=1
11	AFDB:Q9XTL9	0.995	0.994	0.000	844	0.719	0.718	Q9XTL9.pdb.gz	PYG_DROME Glycogen phosphorylase OS=Drosophila melanogaster OX=7227 GN=Glyp PE=2 SV=2
12	AFDB:P0AC86	0.948	0.980	1.767E-93	815	0.485	0.502	P0AC86.pdb.gz	PHSG_ECOLI Glycogen phosphorylase OS=Escherichia coli (strain K12) OX=83333 GN=glgP PE=3 SV=1
13	AFDB:Q00766	0.943	0.932	9.663E-90	853	0.484	0.478	Q00766.pdb.gz	PHS1_DICDI Glycogen phosphorylase 1 OS=Dictyostelium discoideum OX=44689 GN=glpV PE=1 SV=3
14	AFDB:P34114	0.939	0.799	8.354E-86	993	0.480	0.408	P34114.pdb.gz	PHS2_DICDI Glycogen phosphorylase 2 OS=Dictyostelium discoideum OX=44689 GN=glpD PE=1 SV=2
15	AFDB:P06738	0.935	0.874	2.930E-83	902	0.483	0.451	P06738.pdb.gz	PHSG_YEAST Glycogen phosphorylase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GPH1 PE=1 SV=4
16	PDB:1ygpA	0.933	0.917	7.330E-79	858	0.480	0.472	1ygpA.pdb.gz	A protein phosphorylation switch at the conserved allosteric site in GP.
17	PDB:4bqfB	0.925	0.943	6.022E-78	827	0.453	0.462	4bqfB.pdb.gz	Sugar-Coated Sensor Chip and Nanoparticle Surfaces for the in Vitro Enzymatic Synthesis of Starch-Like Materials
18	PDB:1ahpA	0.905	0.958	4.599E-75	796	0.409	0.433	1ahpA.pdb.gz	Oligosaccharide substrate binding in Escherichia coli maltodextrin phosphorylase.
19	PDB:3guhA	0.375	0.618	1.156E-10	477	0.084	0.149	3guhA.pdb.gz	The Crystal Structures of the Open and Catalytically Competent Closed Conformation of Escherichia coli Glycogen Synthase.
20	PDB:4qlbD	0.272	0.337	1.509E-6	651	0.119	0.154	4qlbD.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A1D8PQQ3	744	900	0.458	0.429	A0A1D8PQQ3_CANAL Alpha-1,4 glucan phosphorylase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=GPH1 PE=3 SV=1
2	E1BSN7	1589	843	0.912	0.912	E1BSN7_CHICK Alpha-1,4 glucan phosphorylase OS=Gallus gallus OX=9031 GN=PYGB PE=1 SV=2
3	E7EXT3	1447	842	0.811	0.812	E7EXT3_DANRE Alpha-1,4 glucan phosphorylase OS=Danio rerio OX=7955 GN=zgc:63642 PE=1 SV=1
4	P00489	1481	843	0.837	0.837	PYGM_RABIT Glycogen phosphorylase, muscle form OS=Oryctolagus cuniculus OX=9986 GN=PYGM PE=1 SV=3
5	P00490	682	797	0.416	0.440	PHSM_ECOLI Maltodextrin phosphorylase OS=Escherichia coli (strain K12) OX=83333 GN=malP PE=1 SV=7
6	P06737	1425	847	0.815	0.811	PYGL_HUMAN Glycogen phosphorylase, liver form OS=Homo sapiens OX=9606 GN=PYGL PE=1 SV=4
7	P06738	742	902	0.489	0.457	PHSG_YEAST Glycogen phosphorylase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GPH1 PE=1 SV=4
8	P09811	1439	850	0.817	0.811	PYGL_RAT Glycogen phosphorylase, liver form OS=Rattus norvegicus OX=10116 GN=Pygl PE=1 SV=5
9	P09812	1453	842	0.819	0.819	PYGM_RAT Glycogen phosphorylase, muscle form OS=Rattus norvegicus OX=10116 GN=Pygm PE=1 SV=5
10	P0AC86	816	815	0.482	0.498	PHSG_ECOLI Glycogen phosphorylase OS=Escherichia coli (strain K12) OX=83333 GN=glgP PE=3 SV=1
11	P11216	1759	843	1.000	1.000	PYGB_HUMAN Glycogen phosphorylase, brain form OS=Homo sapiens OX=9606 GN=PYGB PE=1 SV=5
12	P11217	1481	842	0.835	0.836	PYGM_HUMAN Glycogen phosphorylase, muscle form OS=Homo sapiens OX=9606 GN=PYGM PE=1 SV=6
13	P34114	770	993	0.482	0.409	PHS2_DICDI Glycogen phosphorylase 2 OS=Dictyostelium discoideum OX=44689 GN=glpD PE=1 SV=2
14	P53534	1608	838	0.949	0.955	PYGB_RAT Glycogen phosphorylase, brain form (Fragment) OS=Rattus norvegicus OX=10116 GN=Pygb PE=1 SV=3
15	Q00766	821	853	0.485	0.479	PHS1_DICDI Glycogen phosphorylase 1 OS=Dictyostelium discoideum OX=44689 GN=glpV PE=1 SV=3
16	Q503C7	1441	842	0.801	0.802	Q503C7_DANRE Alpha-1,4 glucan phosphorylase OS=Danio rerio OX=7955 GN=im:7150327 PE=1 SV=1
17	Q5ZME4	1585	843	0.910	0.910	Q5ZME4_CHICK Alpha-1,4 glucan phosphorylase OS=Gallus gallus OX=9031 GN=RCJMB04_2f16 PE=2 SV=1
18	Q6FUB0	743	899	0.488	0.457	Q6FUB0_CANGA Alpha-1,4 glucan phosphorylase OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CAGL0F04895g PE=3 SV=1
19	Q8CI94	1622	843	0.956	0.956	PYGB_MOUSE Glycogen phosphorylase, brain form OS=Mus musculus OX=10090 GN=Pygb PE=1 SV=3
20	Q9ET01	1438	850	0.816	0.809	PYGL_MOUSE Glycogen phosphorylase, liver form OS=Mus musculus OX=10090 GN=Pygl PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00343 Phosphorylase	0	1131.2	Carbohydrate phosphorylase
2	PF18833 TPR_22	5.1e+02	12.5	Tetratricopeptide repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000216962

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000294724	0.992	Glycogen debranching enzyme
2	9606.ENSP00000410833	0.992	1,4-alpha-glucan-branching enzyme
3	9606.ENSP00000360124	0.977	Phosphoglucomutase-1
4	9606.ENSP00000216392	0.971	Glycogen phosphorylase, liver form
5	9606.ENSP00000338703	0.969	UTP--glucose-1-phosphate uridylyltransferase
6	9606.ENSP00000340736	0.954	Glycogenin-1
7	9606.ENSP00000313504	0.950	Phosphorylase b kinase regulatory subunit beta
8	9606.ENSP00000362643	0.947	Phosphorylase b kinase regulatory subunit alpha, skeletal muscle isoform
9	9606.ENSP00000445440	0.935	Phosphorylase b kinase gamma catalytic chain, skeletal muscle/heart isoform
10	9606.ENSP00000447378	0.935	Maltase-glucoamylase, intestinal
11	9606.ENSP00000164139	0.931	Glycogen phosphorylase, muscle form
12	9606.ENSP00000371393	0.931	Phosphoglucomutase-2
13	9606.ENSP00000447431	0.925	Probable maltase-glucoamylase 2
14	9606.ENSP00000298198	0.923	Glucose 1,6-bisphosphate synthase
15	9606.ENSP00000354238	0.909	Ectonucleotide pyrophosphatase/phosphodiesterase family member 1
16	9606.ENSP00000406261	0.909	Ectonucleotide pyrophosphatase/phosphodiesterase family member 3
17	9606.ENSP00000317904	0.904	Glycogen [starch] synthase, muscle
18	9606.ENSP00000261195	0.888	Glycogen [starch] synthase, liver
19	9606.ENSP00000354610	0.825	Amylase, alpha 2B
20	9606.ENSP00000269848	0.816	ATP-dependent 6-phosphofructokinase, liver type

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0008184	0.999	glycogen phosphorylase activity
GO:0097159	0.830	organic cyclic compound binding
GO:0042802	0.814	identical protein binding
GO:1901363	0.757	heterocyclic compound binding
GO:0043167	0.732	ion binding
GO:0043168	0.668	anion binding
GO:0036094	0.654	small molecule binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009251	0.996	glucan catabolic process
GO:0044247	0.996	cellular polysaccharide catabolic process
GO:0005977	0.975	glycogen metabolic process
GO:0005980	0.971	glycogen catabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.997	cytoplasm
GO:0043226	0.939	organelle
GO:0005829	0.938	cytosol
GO:0043227	0.926	membrane-bounded organelle
GO:0043229	0.871	intracellular organelle
GO:0005576	0.847	extracellular region
GO:0043231	0.781	intracellular membrane-bounded organelle
GO:0031982	0.606	vesicle
GO:0005615	0.518	extracellular space
GO:0005634	0.420	nucleus
GO:0070062	0.395	extracellular exosome
GO:0012505	0.338	endomembrane system
GO:0031981	0.335	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.4.1.1	0.999	glycogen phosphorylase.

[back to server]