StarFunc result for job id P11217

User Input

>input (842 residues)
MSRPLSDQEKRKQISVRGLAGVENVTELKKNFNRHLHFTLVKDRNVATPRDYYFALAHTV
RDHLVGRWIRTQQHYYEKDPKRIYYLSLEFYMGRTLQNTMVNLALENACDEATYQLGLDM
EELEEIEEDAGLGNGGLGRLAACFLDSMATLGLAAYGYGIRYEFGIFNQKISGGWQMEEA
DDWLRYGNPWEKARPEFTLPVHFYGHVEHTSQGAKWVDTQVVLAMPYDTPVPGYRNNVVN
TMRLWSAKAPNDFNLKDFNVGGYIQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFV
VAATLQDIIRRFKSSKFGCRDPVRTNFDAFPDKVAIQLNDTHPSLAIPELMRILVDLERM
DWDKAWDVTVRTCAYTNHTVLPEALERWPVHLLETLLPRHLQIIYEINQRFLNRVAAAFP
GDVDRLRRMSLVEEGAVKRINMAHLCIAGSHAVNGVARIHSEILKKTIFKDFYELEPHKF
QNKTNGITPRRWLVLCNPGLAEVIAERIGEDFISDLDQLRKLLSFVDDEAFIRDVAKVKQ
ENKLKFAAYLEREYKVHINPNSLFDIQVKRIHEYKRQLLNCLHVITLYNRIKREPNKFFV
PRTVMIGGKAAPGYHMAKMIIRLVTAIGDVVNHDPAVGDRLRVIFLENYRVSLAEKVIPA
ADLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVD
KLDQRGYNAQEYYDRIPELRQVIEQLSSGFFSPKQPDLFKDIVNMLMHHDRFKVFADYED
YIKCQEKVSALYKNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPSRQRLPAPDE
AI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:1e1yA	0.939	0.972	0.000	813	0.939	0.973	1e1yA.pdb.gz	Flavopiridol Inhibits Glycogen Phosphorylase by Binding at the Inhibitor Site
2	PDB:1fa9A	0.951	0.960	0.000	834	0.795	0.802	1fa9A.pdb.gz	Activation of human liver glycogen phosphorylase by alteration of the secondary structure and packing of the catalytic core.
3	PDB:3gpbA	0.971	0.981	0.000	833	0.960	0.970	3gpbA.pdb.gz	Comparison of the binding of glucose and glucose 1-phosphate derivatives to T-state glycogen phosphorylase b.
4	PDB:5ikoA	0.943	0.983	0.000	807	0.803	0.838	5ikoA.pdb.gz	Insights into Brain Glycogen Metabolism: THE STRUCTURE OF HUMAN BRAIN GLYCOGEN PHOSPHORYLASE.
5	AFDB:E1BSN7	0.997	0.996	0.000	843	0.833	0.832	E1BSN7.pdb.gz	E1BSN7_CHICK Alpha-1,4 glucan phosphorylase OS=Gallus gallus OX=9031 GN=PYGB PE=1 SV=2
6	AFDB:E7EXT3	0.968	0.968	0.000	842	0.827	0.827	E7EXT3.pdb.gz	E7EXT3_DANRE Alpha-1,4 glucan phosphorylase OS=Danio rerio OX=7955 GN=zgc:63642 PE=1 SV=1
7	AFDB:P00489	0.970	0.969	0.000	843	0.973	0.972	P00489.pdb.gz	PYGM_RABIT Glycogen phosphorylase, muscle form OS=Oryctolagus cuniculus OX=9986 GN=PYGM PE=1 SV=3
8	AFDB:P09811	0.984	0.975	0.000	850	0.800	0.793	P09811.pdb.gz	PYGL_RAT Glycogen phosphorylase, liver form OS=Rattus norvegicus OX=10116 GN=Pygl PE=1 SV=5
9	AFDB:Q503C7	0.969	0.969	0.000	842	0.847	0.847	Q503C7.pdb.gz	Q503C7_DANRE Alpha-1,4 glucan phosphorylase OS=Danio rerio OX=7955 GN=im:7150327 PE=1 SV=1
10	AFDB:Q9XTL9	0.968	0.965	0.000	844	0.732	0.730	Q9XTL9.pdb.gz	PYG_DROME Glycogen phosphorylase OS=Drosophila melanogaster OX=7227 GN=Glyp PE=2 SV=2
11	PDB:2qllA	0.919	0.960	1.367E-100	806	0.771	0.805	2qllA.pdb.gz	Molecular recognition of the protein phosphatase 1 glycogen targeting subunit by glycogen phosphorylase.
12	AFDB:P0AC86	0.941	0.972	5.380E-88	815	0.471	0.487	P0AC86.pdb.gz	PHSG_ECOLI Glycogen phosphorylase OS=Escherichia coli (strain K12) OX=83333 GN=glgP PE=3 SV=1
13	AFDB:Q00766	0.918	0.907	3.164E-83	853	0.471	0.465	Q00766.pdb.gz	PHS1_DICDI Glycogen phosphorylase 1 OS=Dictyostelium discoideum OX=44689 GN=glpV PE=1 SV=3
14	AFDB:P34114	0.924	0.785	1.763E-79	993	0.460	0.390	P34114.pdb.gz	PHS2_DICDI Glycogen phosphorylase 2 OS=Dictyostelium discoideum OX=44689 GN=glpD PE=1 SV=2
15	AFDB:Q6FUB0	0.923	0.865	2.015E-79	899	0.470	0.440	Q6FUB0.pdb.gz	Q6FUB0_CANGA Alpha-1,4 glucan phosphorylase OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CAGL0F04895g PE=3 SV=1
16	PDB:4bqfB	0.915	0.931	2.088E-74	827	0.462	0.470	4bqfB.pdb.gz	Sugar-Coated Sensor Chip and Nanoparticle Surfaces for the in Vitro Enzymatic Synthesis of Starch-Like Materials
17	PDB:1ygpA	0.913	0.896	5.807E-74	858	0.469	0.460	1ygpA.pdb.gz	A protein phosphorylation switch at the conserved allosteric site in GP.
18	PDB:1ahpA	0.904	0.955	5.000E-71	796	0.409	0.432	1ahpA.pdb.gz	Oligosaccharide substrate binding in Escherichia coli maltodextrin phosphorylase.
19	PDB:3guhA	0.427	0.704	1.877E-10	477	0.090	0.159	3guhA.pdb.gz	The Crystal Structures of the Open and Catalytically Competent Closed Conformation of Escherichia coli Glycogen Synthase.
20	PDB:4qlbD	0.294	0.366	3.292E-7	651	0.102	0.132	4qlbD.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A1D8PQQ3	751	900	0.468	0.438	A0A1D8PQQ3_CANAL Alpha-1,4 glucan phosphorylase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=GPH1 PE=3 SV=1
2	E1BSN7	1462	843	0.833	0.832	E1BSN7_CHICK Alpha-1,4 glucan phosphorylase OS=Gallus gallus OX=9031 GN=PYGB PE=1 SV=2
3	E7EXT3	1481	842	0.828	0.828	E7EXT3_DANRE Alpha-1,4 glucan phosphorylase OS=Danio rerio OX=7955 GN=zgc:63642 PE=1 SV=1
4	P00489	1725	843	0.974	0.973	PYGM_RABIT Glycogen phosphorylase, muscle form OS=Oryctolagus cuniculus OX=9986 GN=PYGM PE=1 SV=3
5	P00490	688	797	0.413	0.437	PHSM_ECOLI Maltodextrin phosphorylase OS=Escherichia coli (strain K12) OX=83333 GN=malP PE=1 SV=7
6	P04045	587	966	0.413	0.360	PHSL1_SOLTU Alpha-1,4 glucan phosphorylase L-1 isozyme, chloroplastic/amyloplastic OS=Solanum tuberosum OX=4113 PE=1 SV=2
7	P06737	1407	847	0.799	0.795	PYGL_HUMAN Glycogen phosphorylase, liver form OS=Homo sapiens OX=9606 GN=PYGL PE=1 SV=4
8	P06738	741	902	0.480	0.448	PHSG_YEAST Glycogen phosphorylase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GPH1 PE=1 SV=4
9	P09811	1417	850	0.802	0.794	PYGL_RAT Glycogen phosphorylase, liver form OS=Rattus norvegicus OX=10116 GN=Pygl PE=1 SV=5
10	P09812	1649	842	0.952	0.952	PYGM_RAT Glycogen phosphorylase, muscle form OS=Rattus norvegicus OX=10116 GN=Pygm PE=1 SV=5
11	P0AC86	803	815	0.471	0.487	PHSG_ECOLI Glycogen phosphorylase OS=Escherichia coli (strain K12) OX=83333 GN=glgP PE=3 SV=1
12	P11216	1469	843	0.836	0.835	PYGB_HUMAN Glycogen phosphorylase, brain form OS=Homo sapiens OX=9606 GN=PYGB PE=1 SV=5
13	P11217	1756	842	1.000	1.000	PYGM_HUMAN Glycogen phosphorylase, muscle form OS=Homo sapiens OX=9606 GN=PYGM PE=1 SV=6
14	P34114	756	993	0.463	0.393	PHS2_DICDI Glycogen phosphorylase 2 OS=Dictyostelium discoideum OX=44689 GN=glpD PE=1 SV=2
15	P53534	1458	838	0.842	0.846	PYGB_RAT Glycogen phosphorylase, brain form (Fragment) OS=Rattus norvegicus OX=10116 GN=Pygb PE=1 SV=3
16	Q00766	807	853	0.470	0.464	PHS1_DICDI Glycogen phosphorylase 1 OS=Dictyostelium discoideum OX=44689 GN=glpV PE=1 SV=3
17	Q503C7	1509	842	0.848	0.848	Q503C7_DANRE Alpha-1,4 glucan phosphorylase OS=Danio rerio OX=7955 GN=im:7150327 PE=1 SV=1
18	Q5ZME4	1457	843	0.830	0.829	Q5ZME4_CHICK Alpha-1,4 glucan phosphorylase OS=Gallus gallus OX=9031 GN=RCJMB04_2f16 PE=2 SV=1
19	Q6FUB0	751	899	0.487	0.456	Q6FUB0_CANGA Alpha-1,4 glucan phosphorylase OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CAGL0F04895g PE=3 SV=1
20	Q8CI94	1453	843	0.840	0.839	PYGB_MOUSE Glycogen phosphorylase, brain form OS=Mus musculus OX=10090 GN=Pygb PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06481 COX_ARM	77	14.6	COX Aromatic Rich Motif
2	PF00343 Phosphorylase	0	1135.2	Carbohydrate phosphorylase
3	PF14615 Rsa3	68	14.5	Ribosome-assembly protein 3

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000164139

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000294724	0.993	Glycogen debranching enzyme
2	9606.ENSP00000410833	0.992	1,4-alpha-glucan-branching enzyme
3	9606.ENSP00000360124	0.979	Phosphoglucomutase-1
4	9606.ENSP00000445440	0.966	Phosphorylase b kinase gamma catalytic chain, skeletal muscle/heart isoform
5	9606.ENSP00000362643	0.962	Phosphorylase b kinase regulatory subunit alpha, skeletal muscle isoform
6	9606.ENSP00000338703	0.961	UTP--glucose-1-phosphate uridylyltransferase
7	9606.ENSP00000313504	0.958	Phosphorylase b kinase regulatory subunit beta
8	9606.ENSP00000340736	0.953	Glycogenin-1
9	9606.ENSP00000216392	0.931	Glycogen phosphorylase, liver form
10	9606.ENSP00000216962	0.931	Glycogen phosphorylase, brain form
11	9606.ENSP00000447378	0.931	Maltase-glucoamylase, intestinal
12	9606.ENSP00000371393	0.930	Phosphoglucomutase-2
13	9606.ENSP00000354238	0.929	Ectonucleotide pyrophosphatase/phosphodiesterase family member 1
14	9606.ENSP00000447431	0.924	Probable maltase-glucoamylase 2
15	9606.ENSP00000298198	0.923	Glucose 1,6-bisphosphate synthase
16	9606.ENSP00000317904	0.910	Glycogen [starch] synthase, muscle
17	9606.ENSP00000406261	0.909	Ectonucleotide pyrophosphatase/phosphodiesterase family member 3
18	9606.ENSP00000261195	0.892	Glycogen [starch] synthase, liver
19	9606.ENSP00000324105	0.847	Beta-enolase
20	9606.ENSP00000367123	0.839	4F2 cell-surface antigen heavy chain

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008184	0.999	glycogen phosphorylase activity
GO:0005515	0.998	protein binding
GO:0097159	0.820	organic cyclic compound binding
GO:0042802	0.795	identical protein binding
GO:0043167	0.786	ion binding
GO:1901363	0.749	heterocyclic compound binding
GO:0043168	0.734	anion binding
GO:0036094	0.688	small molecule binding
GO:0030246	0.509	carbohydrate binding
GO:0019842	0.361	vitamin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005980	0.997	glycogen catabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.997	cytoplasm
GO:0005829	0.953	cytosol
GO:0043226	0.949	organelle
GO:0043227	0.912	membrane-bounded organelle
GO:0043229	0.905	intracellular organelle
GO:0043231	0.778	intracellular membrane-bounded organelle
GO:0070013	0.391	intracellular organelle lumen
GO:0031981	0.376	nuclear lumen
GO:0012505	0.353	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.4.1.1	0.999	glycogen phosphorylase.

[back to server]