StarFunc result for job id P11233

User Input

>input (206 residues)
MAANKPKGQNSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGE
EVQIDILDTAGQEDYAAIRDNYFRSGEGFLCVFSITEMESFAATADFREQILRVKEDENV
PFLLVGNKSDLEDKRQVSVEEAKNRAEQWNVNYVETSAKTRANVDKVFFDLMREIRARKM
EDSKEKNGKKKRKSLAKRIRERCCIL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P11233	1.000	1.000	1.288E-42	206	1.000	1.000	P11233.pdb.gz	RALA_HUMAN Ras-related protein Ral-A OS=Homo sapiens OX=9606 GN=RALA PE=1 SV=1
2	AFDB:P11234	0.915	0.915	8.755E-35	206	0.796	0.796	P11234.pdb.gz	RALB_HUMAN Ras-related protein Ral-B OS=Homo sapiens OX=9606 GN=RALB PE=1 SV=1
3	AFDB:P48555	0.915	0.938	1.663E-34	201	0.748	0.766	P48555.pdb.gz	RALA_DROME Ras-related protein Ral-a OS=Drosophila melanogaster OX=7227 GN=Rala PE=1 SV=2
4	AFDB:H2L0Q6	0.838	0.682	4.151E-32	254	0.636	0.516	H2L0Q6.pdb.gz	H2L0Q6_CAEEL Small monomeric GTPase OS=Caenorhabditis elegans OX=6239 GN=ral-1 PE=1 SV=1
5	PDB:2bovA	0.820	0.974	1.069E-31	173	0.835	0.994	2bovA.pdb.gz	Molecular Recognition of an Adp-Ribosylating Clostridium Botulinum C3 Exoenzyme by Rala Gtpase
6	PDB:6zqtA	0.816	0.970	2.182E-30	173	0.718	0.855	6zqtA.pdb.gz	Affinity maturation of the RLIP76 Ral binding domain to inform the design of stapled peptides targeting the Ral GTPases.
7	AFDB:Q5CCJ5	0.857	0.881	2.424E-27	200	0.447	0.460	Q5CCJ5.pdb.gz	Q5CCJ5_BOMMO Ras oncogene OS=Bombyx mori OX=7091 GN=Bras2 PE=2 SV=1
8	AFDB:Q6AZA4	0.857	0.937	2.424E-27	188	0.466	0.511	Q6AZA4.pdb.gz	Q6AZA4_DANRE GTPase KRas OS=Danio rerio OX=7955 GN=K-ras PE=1 SV=1
9	AFDB:P03967	0.831	0.913	3.562E-27	187	0.442	0.487	P03967.pdb.gz	RASD_DICDI Ras-like protein rasD OS=Dictyostelium discoideum OX=44689 GN=rasD PE=1 SV=2
10	AFDB:P0CY32	0.830	0.600	4.050E-27	290	0.432	0.307	P0CY32.pdb.gz	RAS1_CANAX Ras-like protein 1 OS=Candida albicans OX=5476 GN=RAS1 PE=3 SV=1
11	AFDB:P01111	0.827	0.900	6.347E-27	189	0.437	0.476	P01111.pdb.gz	RASN_HUMAN GTPase NRas OS=Homo sapiens OX=9606 GN=NRAS PE=1 SV=1
12	AFDB:P15064	0.807	0.878	6.768E-27	189	0.442	0.481	P15064.pdb.gz	RASG_DICDI Ras-like protein rasG OS=Dictyostelium discoideum OX=44689 GN=rasG PE=1 SV=1
13	PDB:6zizA	0.804	0.971	8.131E-26	170	0.437	0.529	6zizA.pdb.gz	Drugging all RAS isoforms with one pocket.
14	PDB:6kykC	0.787	0.957	3.180E-23	169	0.413	0.503	6kykC.pdb.gz	Shank3 Binds to and Stabilizes the Active Form of Rap1 and HRas GTPases via Its NTD-ANK Tandem with Distinct Mechanisms.
15	PDB:7sd0B	0.787	0.927	3.615E-23	174	0.393	0.466	7sd0B.pdb.gz	Structural basis for SHOC2 modulation of RAS signalling.
16	PDB:5cm8B	0.734	0.890	6.442E-23	169	0.699	0.852	5cm8B.pdb.gz
17	PDB:1kaoA	0.773	0.948	2.362E-20	167	0.369	0.455	1kaoA.pdb.gz	Crystal structures of the small G protein Rap2A in complex with its substrate GTP, with GDP and with GTPgammaS.
18	PDB:7kyzA	0.740	0.805	1.425E-19	188	0.451	0.495	7kyzA.pdb.gz
19	PDB:5szjA	0.743	0.869	2.251E-18	175	0.272	0.320	5szjA.pdb.gz	bMERB domains are bivalent Rab8 family effectors evolved by gene duplication.
20	PDB:1vg8A	0.778	0.867	3.103E-18	184	0.291	0.326	1vg8A.pdb.gz	Structure of the Rab7:REP-1 complex: insights into the mechanism of Rab prenylation and choroideremia disease

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P11233	1.37e-152	422	206	1.000	1.000	RALA_HUMAN Ras-related protein Ral-A OS=Homo sapiens OX=9606 GN=RALA PE=1 SV=1
2	P63320	5.60e-152	421	206	0.995	0.995	RALA_SAGOE Ras-related protein Ral-A OS=Saguinus oedipus OX=9490 GN=RALA PE=1 SV=1
3	P63321	5.60e-152	421	206	0.995	0.995	RALA_MOUSE Ras-related protein Ral-A OS=Mus musculus OX=10090 GN=Rala PE=1 SV=1
4	P63322	5.60e-152	421	206	0.995	0.995	RALA_RAT Ras-related protein Ral-A OS=Rattus norvegicus OX=10116 GN=Rala PE=1 SV=1
5	P36860	1.11e-117	334	206	0.816	0.816	RALB_RAT Ras-related protein Ral-B OS=Rattus norvegicus OX=10116 GN=Ralb PE=2 SV=1
6	P11234	3.04e-116	331	206	0.816	0.816	RALB_HUMAN Ras-related protein Ral-B OS=Homo sapiens OX=9606 GN=RALB PE=1 SV=1
7	Q9YH09	5.14e-113	323	206	0.796	0.796	RALBA_XENLA Ras-related protein ralB-A OS=Xenopus laevis OX=8355 GN=ralb-a PE=1 SV=1
8	P48555	6.39e-110	315	201	0.752	0.771	RALA_DROME Ras-related protein Ral-a OS=Drosophila melanogaster OX=7227 GN=Rala PE=1 SV=2
9	Q6IQE6	1.77e-109	313	206	0.728	0.728	Q6IQE6_DANRE V-ral simian leukemia viral oncogene homolog Bb (Ras related) OS=Danio rerio OX=7955 GN=zgc:86798 PE=1 SV=1
10	Q9N3F8	2.10e-95	278	213	0.689	0.667	Q9N3F8_CAEEL Small monomeric GTPase OS=Caenorhabditis elegans OX=6239 GN=ral-1 PE=1 SV=1
11	H2L0Q6	3.71e-94	276	254	0.689	0.559	H2L0Q6_CAEEL Small monomeric GTPase OS=Caenorhabditis elegans OX=6239 GN=ral-1 PE=1 SV=1
12	P32254	3.37e-61	191	194	0.442	0.469	RASS_DICDI Ras-like protein rasS OS=Dictyostelium discoideum OX=44689 GN=rasS PE=2 SV=1
13	P15064	5.29e-61	190	189	0.471	0.513	RASG_DICDI Ras-like protein rasG OS=Dictyostelium discoideum OX=44689 GN=rasG PE=1 SV=1
14	B5XGC1	1.14e-60	189	184	0.442	0.495	B5XGC1_SALSA small monomeric GTPase OS=Salmo salar OX=8030 GN=RAP1B PE=2 SV=1
15	P03967	1.05e-59	187	187	0.471	0.519	RASD_DICDI Ras-like protein rasD OS=Dictyostelium discoideum OX=44689 GN=rasD PE=1 SV=2
16	Q6TEN1	1.22e-59	186	184	0.437	0.489	RAP1B_DANRE Ras-related protein Rap-1b OS=Danio rerio OX=7955 GN=rap1b PE=2 SV=1
17	B5XFY1	1.51e-59	186	185	0.422	0.470	B5XFY1_SALSA small monomeric GTPase OS=Salmo salar OX=8030 GN=RAP1B PE=2 SV=1
18	Q6IQP4	2.14e-59	186	185	0.442	0.492	Q6IQP4_DANRE small monomeric GTPase OS=Danio rerio OX=7955 GN=rap1a PE=1 SV=1
19	B5X2X6	3.94e-59	185	185	0.422	0.470	B5X2X6_SALSA small monomeric GTPase OS=Salmo salar OX=8030 GN=RAP1B PE=2 SV=1
20	B5X794	5.24e-59	185	185	0.422	0.470	B5X794_SALSA small monomeric GTPase OS=Salmo salar OX=8030 GN=RAP1B PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13481 AAA_25	6.3	17.8	AAA domain
2	PF00025 Arf	3.2e-07	41.5	ADP-ribosylation factor family
3	PF00009 GTP_EFTU	0.097	23.7	Elongation factor Tu GTP binding domain
4	PF03308 MeaB	5.2e+02	11.0	Methylmalonyl Co-A mutase-associated GTPase MeaB
5	PF01926 MMR_HSR1	5.7	18.5	50S ribosome-binding GTPase
6	PF16897 MMR_HSR1_Xtn	1.8e+02	13.5	C-terminal region of MMR_HSR1 domain
7	PF00071 Ras	1e-52	189.5	Ras family
8	PF08477 Roc	1.5e-15	68.9	Ras of Complex, Roc, domain of DAPkinase
9	PF03193 RsgA_GTPase	8.2e-06	37.3	RsgA GTPase
10	PF00735 Septin	28	15.5	Septin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000023909

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000013145	0.998	Component of the exocyst complex involved in the docking of exocytic vesicles with fusion sites on the plasma membrane.
2	61853.ENSNLEP00000008470	0.997	ralA binding protein 1
3	61853.ENSNLEP00000015840	0.981	Ral guanine nucleotide dissociation stimulator
4	61853.ENSNLEP00000022706	0.980	Exocyst complex component 8
5	61853.ENSNLEP00000006616	0.979	Phospholipase D1, phosphatidylcholine-specific
6	61853.ENSNLEP00000021134	0.959	Phospholipase D2
7	61853.ENSNLEP00000015761	0.948	Exocyst complex component 4
8	61853.ENSNLEP00000021896	0.946	annotation not available
9	61853.ENSNLEP00000011344	0.938	Mitogen-activated protein kinase 10
10	61853.ENSNLEP00000002611	0.937	Mitogen-activated protein kinase 9
11	61853.ENSNLEP00000018944	0.937	Mitogen-activated protein kinase 8
12	61853.ENSNLEP00000015778	0.926	Exocyst complex component 5
13	61853.ENSNLEP00000001083	0.923	RAS like proto-oncogene B
14	61853.ENSNLEP00000017956	0.917	Ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2)
15	61853.ENSNLEP00000023357	0.884	Ras homolog family member A
16	61853.ENSNLEP00000004143	0.875	Y box binding protein 3
17	61853.ENSNLEP00000000882	0.803	Myosin IC
18	61853.ENSNLEP00000002580	0.775	Exocyst complex component 7
19	61853.ENSNLEP00000007777	0.774	Ral GTPase activating protein, beta subunit (non-catalytic)
20	61853.ENSNLEP00000023771	0.742	Uncharacterized protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003924	1.000	GTPase activity
GO:0005525	0.999	GTP binding
GO:0019003	0.998	GDP binding
GO:0019899	0.582	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.994	regulation of cellular process
GO:0009987	0.988	cellular process
GO:0050896	0.973	response to stimulus
GO:0032879	0.919	regulation of localization
GO:0051128	0.901	regulation of cellular component organization
GO:0044087	0.899	regulation of cellular component biogenesis
GO:0048583	0.877	regulation of response to stimulus
GO:0048518	0.867	positive regulation of biological process
GO:0007265	0.859	Ras protein signal transduction
GO:0032501	0.841	multicellular organismal process
GO:0051130	0.840	positive regulation of cellular component organization
GO:0048856	0.825	anatomical structure development
GO:0071840	0.810	cellular component organization or biogenesis
GO:0009966	0.785	regulation of signal transduction
GO:0030100	0.779	regulation of endocytosis
GO:0016043	0.775	cellular component organization
GO:0007275	0.768	multicellular organism development
GO:0051179	0.733	localization
GO:0019222	0.701	regulation of metabolic process
GO:0065008	0.679	regulation of biological quality
GO:0048584	0.677	positive regulation of response to stimulus
GO:0006996	0.667	organelle organization
GO:0009967	0.664	positive regulation of signal transduction
GO:1901184	0.660	regulation of ERBB signaling pathway
GO:0042058	0.604	regulation of epidermal growth factor receptor signaling pathway
GO:0051234	0.601	establishment of localization
GO:0006810	0.591	transport
GO:1901186	0.582	positive regulation of ERBB signaling pathway
GO:0009653	0.482	anatomical structure morphogenesis
GO:0031323	0.464	regulation of cellular metabolic process
GO:0009893	0.440	positive regulation of metabolic process
GO:0080090	0.410	regulation of primary metabolic process
GO:0051641	0.402	cellular localization
GO:0060255	0.396	regulation of macromolecule metabolic process
GO:0048519	0.394	negative regulation of biological process
GO:0051171	0.388	regulation of nitrogen compound metabolic process
GO:0048523	0.382	negative regulation of cellular process
GO:0010604	0.338	positive regulation of macromolecule metabolic process
GO:0065009	0.335	regulation of molecular function
GO:1902531	0.326	regulation of intracellular signal transduction
GO:0042221	0.316	response to chemical
GO:0048259	0.307	regulation of receptor-mediated endocytosis
GO:0006950	0.305	response to stress
GO:0045742	0.302	positive regulation of epidermal growth factor receptor signaling pathway

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0043227	0.999	membrane-bounded organelle
GO:0005737	0.999	cytoplasm
GO:0071944	0.998	cell periphery
GO:0005829	0.992	cytosol
GO:0005886	0.985	plasma membrane
GO:0043229	0.981	intracellular organelle
GO:0043231	0.944	intracellular membrane-bounded organelle
GO:0005576	0.913	extracellular region
GO:1903561	0.886	extracellular vesicle
GO:0070062	0.879	extracellular exosome
GO:0012505	0.753	endomembrane system
GO:0031410	0.724	cytoplasmic vesicle
GO:0031090	0.659	organelle membrane
GO:0030054	0.485	cell junction
GO:0043228	0.316	non-membrane-bounded organelle
GO:0098588	0.301	bounding membrane of organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:19669	1.000	GTP + H2O = GDP + H(+) + phosphate

[back to server]