StarFunc result for job id P11234

User Input

>input (206 residues)
MAANKSKGQSSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGE
EVQIDILDTAGQEDYAAIRDNYFRSGEGFLLVFSITEHESFTATAEFREQILRVKAEEDK
IPLLVVGNKSDLEERRQVPVEEARSKAEEWGVQYVETSAKTRANVDKVFFDLMREIRTKK
MSENKDKNGKKSSKNKKSFKERCCLL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P11234	1.000	1.000	3.748E-43	206	1.000	1.000	P11234.pdb.gz	RALB_HUMAN Ras-related protein Ral-B OS=Homo sapiens OX=9606 GN=RALB PE=1 SV=1
2	AFDB:P11233	0.945	0.945	8.149E-35	206	0.825	0.825	P11233.pdb.gz	RALA_HUMAN Ras-related protein Ral-A OS=Homo sapiens OX=9606 GN=RALA PE=1 SV=1
3	AFDB:P48555	0.938	0.961	1.361E-33	201	0.709	0.726	P48555.pdb.gz	RALA_DROME Ras-related protein Ral-a OS=Drosophila melanogaster OX=7227 GN=Rala PE=1 SV=2
4	PDB:6zqtA	0.823	0.978	2.095E-31	173	0.830	0.988	6zqtA.pdb.gz	Affinity maturation of the RLIP76 Ral binding domain to inform the design of stapled peptides targeting the Ral GTPases.
5	AFDB:H2L0Q6	0.847	0.694	1.127E-30	254	0.617	0.500	H2L0Q6.pdb.gz	H2L0Q6_CAEEL Small monomeric GTPase OS=Caenorhabditis elegans OX=6239 GN=ral-1 PE=1 SV=1
6	PDB:2bovA	0.815	0.968	4.530E-28	173	0.723	0.861	2bovA.pdb.gz	Molecular Recognition of an Adp-Ribosylating Clostridium Botulinum C3 Exoenzyme by Rala Gtpase
7	AFDB:P03967	0.782	0.859	1.557E-27	187	0.456	0.503	P03967.pdb.gz	RASD_DICDI Ras-like protein rasD OS=Dictyostelium discoideum OX=44689 GN=rasD PE=1 SV=2
8	AFDB:P08647	0.870	0.821	2.956E-26	219	0.447	0.420	P08647.pdb.gz	RAS_SCHPO Ras-like protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ras1 PE=1 SV=2
9	AFDB:Q5CCJ5	0.885	0.911	4.071E-26	200	0.461	0.475	Q5CCJ5.pdb.gz	Q5CCJ5_BOMMO Ras oncogene OS=Bombyx mori OX=7091 GN=Bras2 PE=2 SV=1
10	AFDB:P01120	0.809	0.524	1.063E-25	322	0.427	0.273	P01120.pdb.gz	RAS2_YEAST Ras-like protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RAS2 PE=1 SV=4
11	AFDB:P15064	0.778	0.847	1.664E-25	189	0.485	0.529	P15064.pdb.gz	RASG_DICDI Ras-like protein rasG OS=Dictyostelium discoideum OX=44689 GN=rasG PE=1 SV=1
12	AFDB:P01119	0.804	0.540	2.442E-25	309	0.427	0.285	P01119.pdb.gz	RAS1_YEAST Ras-like protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RAS1 PE=1 SV=2
13	PDB:6zizA	0.797	0.962	7.128E-23	170	0.427	0.518	6zizA.pdb.gz	Drugging all RAS isoforms with one pocket.
14	PDB:7sd0B	0.781	0.919	4.559E-22	174	0.374	0.443	7sd0B.pdb.gz	Structural basis for SHOC2 modulation of RAS signalling.
15	PDB:6kykC	0.784	0.952	8.110E-22	169	0.388	0.473	6kykC.pdb.gz	Shank3 Binds to and Stabilizes the Active Form of Rap1 and HRas GTPases via Its NTD-ANK Tandem with Distinct Mechanisms.
16	PDB:5cm8B	0.726	0.879	4.016E-21	169	0.665	0.811	5cm8B.pdb.gz
17	PDB:1kaoA	0.779	0.956	1.355E-20	167	0.379	0.467	1kaoA.pdb.gz	Crystal structures of the small G protein Rap2A in complex with its substrate GTP, with GDP and with GTPgammaS.
18	PDB:7kyzA	0.724	0.788	9.248E-19	188	0.461	0.505	7kyzA.pdb.gz
19	PDB:5szjA	0.770	0.903	6.306E-18	175	0.262	0.309	5szjA.pdb.gz	bMERB domains are bivalent Rab8 family effectors evolved by gene duplication.
20	PDB:5sziA	0.794	0.934	2.929E-17	174	0.272	0.322	5sziA.pdb.gz	bMERB domains are bivalent Rab8 family effectors evolved by gene duplication.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P11234	2.38e-152	422	206	1.000	1.000	RALB_HUMAN Ras-related protein Ral-B OS=Homo sapiens OX=9606 GN=RALB PE=1 SV=1
2	P36860	1.60e-138	387	206	0.956	0.956	RALB_RAT Ras-related protein Ral-B OS=Rattus norvegicus OX=10116 GN=Ralb PE=2 SV=1
3	Q9YH09	1.21e-134	377	206	0.942	0.942	RALBA_XENLA Ras-related protein ralB-A OS=Xenopus laevis OX=8355 GN=ralb-a PE=1 SV=1
4	Q6IQE6	1.90e-127	359	206	0.913	0.913	Q6IQE6_DANRE V-ral simian leukemia viral oncogene homolog Bb (Ras related) OS=Danio rerio OX=7955 GN=zgc:86798 PE=1 SV=1
5	P11233	5.39e-117	333	206	0.825	0.825	RALA_HUMAN Ras-related protein Ral-A OS=Homo sapiens OX=9606 GN=RALA PE=1 SV=1
6	P63320	1.99e-116	331	206	0.820	0.820	RALA_SAGOE Ras-related protein Ral-A OS=Saguinus oedipus OX=9490 GN=RALA PE=1 SV=1
7	P63321	1.99e-116	331	206	0.820	0.820	RALA_MOUSE Ras-related protein Ral-A OS=Mus musculus OX=10090 GN=Rala PE=1 SV=1
8	P63322	1.99e-116	331	206	0.820	0.820	RALA_RAT Ras-related protein Ral-A OS=Rattus norvegicus OX=10116 GN=Rala PE=1 SV=1
9	P48555	5.48e-103	297	201	0.714	0.731	RALA_DROME Ras-related protein Ral-a OS=Drosophila melanogaster OX=7227 GN=Rala PE=1 SV=2
10	Q9N3F8	1.64e-91	268	213	0.636	0.615	Q9N3F8_CAEEL Small monomeric GTPase OS=Caenorhabditis elegans OX=6239 GN=ral-1 PE=1 SV=1
11	H2L0Q6	2.72e-90	267	254	0.636	0.516	H2L0Q6_CAEEL Small monomeric GTPase OS=Caenorhabditis elegans OX=6239 GN=ral-1 PE=1 SV=1
12	P15064	6.06e-58	182	189	0.481	0.524	RASG_DICDI Ras-like protein rasG OS=Dictyostelium discoideum OX=44689 GN=rasG PE=1 SV=1
13	B5XGC1	7.56e-57	179	184	0.437	0.489	B5XGC1_SALSA small monomeric GTPase OS=Salmo salar OX=8030 GN=RAP1B PE=2 SV=1
14	Q6IQP4	8.42e-57	179	185	0.417	0.465	Q6IQP4_DANRE small monomeric GTPase OS=Danio rerio OX=7955 GN=rap1a PE=1 SV=1
15	P32253	9.86e-57	179	189	0.417	0.455	RASC_DICDI Ras-like protein rasC OS=Dictyostelium discoideum OX=44689 GN=rasC PE=1 SV=1
16	P08646	9.97e-57	179	189	0.451	0.492	RAS1_DROME Ras-like protein 1 OS=Drosophila melanogaster OX=7227 GN=Ras85D PE=1 SV=2
17	P03967	1.24e-56	179	187	0.456	0.503	RASD_DICDI Ras-like protein rasD OS=Dictyostelium discoideum OX=44689 GN=rasD PE=1 SV=2
18	Q18246	1.82e-56	179	188	0.413	0.452	RAP1_CAEEL Ras-related protein Rap-1 OS=Caenorhabditis elegans OX=6239 GN=rap-1 PE=3 SV=1
19	P32254	2.22e-56	179	194	0.417	0.443	RASS_DICDI Ras-like protein rasS OS=Dictyostelium discoideum OX=44689 GN=rasS PE=2 SV=1
20	P08645	6.61e-56	177	184	0.398	0.446	RAP1_DROME Ras-related protein Rap1 OS=Drosophila melanogaster OX=7227 GN=Rap1 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13479 AAA_24	1.8e+02	13.2	AAA domain
2	PF13481 AAA_25	14	16.7	AAA domain
3	PF00025 Arf	2.3e-06	38.7	ADP-ribosylation factor family
4	PF02421 FeoB_N	1.9e+02	13.0	Ferrous iron transport protein B
5	PF00009 GTP_EFTU	0.2	22.7	Elongation factor Tu GTP binding domain
6	PF04670 Gtr1_RagA	3.1	18.7	Gtr1/RagA G protein conserved region
7	PF01926 MMR_HSR1	1.8	20.0	50S ribosome-binding GTPase
8	PF00071 Ras	3.4e-51	184.6	Ras family
9	PF08477 Roc	5.6e-17	73.5	Ras of Complex, Roc, domain of DAPkinase
10	PF03193 RsgA_GTPase	5e-06	38.0	RsgA GTPase
11	PF00735 Septin	30	15.4	Septin
12	PF06821 Ser_hydrolase	4.5e+02	12.1	Serine hydrolase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000272519

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000019317	0.999	RalA-binding protein 1
2	9606.ENSP00000230449	0.999	Exocyst complex component 2
3	9606.ENSP00000355605	0.998	Exocyst complex component 8
4	9606.ENSP00000361120	0.985	Ral guanine nucleotide dissociation stimulator
5	9606.ENSP00000303192	0.941	Ral guanine nucleotide dissociation stimulator-like 1
6	9606.ENSP00000420211	0.938	Ral guanine nucleotide dissociation stimulator-like 2
7	9606.ENSP00000229795	0.930	Mitogen-activated protein kinase 14
8	9606.ENSP00000378974	0.929	Mitogen-activated protein kinase 8
9	9606.ENSP00000407586	0.926	GTPase HRas
10	9606.ENSP00000362680	0.925	Proto-oncogene tyrosine-protein kinase Src
11	9606.ENSP00000352157	0.924	Mitogen-activated protein kinase 10
12	9606.ENSP00000394560	0.923	Mitogen-activated protein kinase 9
13	9606.ENSP00000333685	0.918	Mitogen-activated protein kinase 11
14	9606.ENSP00000342793	0.916	Phospholipase D1
15	9606.ENSP00000256078	0.914	GTPase KRas
16	9606.ENSP00000358548	0.913	GTPase NRas
17	9606.ENSP00000005257	0.904	Ras-related protein Ral-A
18	9606.ENSP00000379140	0.903	Stromal cell-derived factor 1
19	9606.ENSP00000386884	0.903	C-X-C chemokine receptor type 4
20	9606.ENSP00000263088	0.862	Phospholipase D2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003924	1.000	GTPase activity
GO:0005525	0.997	GTP binding
GO:0019003	0.992	GDP binding
GO:0019899	0.805	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.989	regulation of cellular process
GO:0009987	0.986	cellular process
GO:0050896	0.970	response to stimulus
GO:0007165	0.927	signal transduction
GO:0007264	0.891	small GTPase mediated signal transduction
GO:0051128	0.874	regulation of cellular component organization
GO:0048518	0.868	positive regulation of biological process
GO:0032879	0.839	regulation of localization
GO:0019222	0.838	regulation of metabolic process
GO:0048522	0.831	positive regulation of cellular process
GO:0044087	0.823	regulation of cellular component biogenesis
GO:0048583	0.810	regulation of response to stimulus
GO:0071840	0.766	cellular component organization or biogenesis
GO:0032501	0.760	multicellular organismal process
GO:0048856	0.757	anatomical structure development
GO:0016043	0.753	cellular component organization
GO:0009966	0.742	regulation of signal transduction
GO:0031323	0.723	regulation of cellular metabolic process
GO:0051179	0.687	localization
GO:1901184	0.678	regulation of ERBB signaling pathway
GO:0006996	0.667	organelle organization
GO:0042058	0.664	regulation of epidermal growth factor receptor signaling pathway
GO:0009653	0.651	anatomical structure morphogenesis
GO:0051049	0.625	regulation of transport
GO:0060255	0.531	regulation of macromolecule metabolic process
GO:0048584	0.490	positive regulation of response to stimulus
GO:0042221	0.461	response to chemical
GO:0009893	0.457	positive regulation of metabolic process
GO:0080090	0.424	regulation of primary metabolic process
GO:0051171	0.422	regulation of nitrogen compound metabolic process
GO:0009967	0.422	positive regulation of signal transduction
GO:0006950	0.420	response to stress
GO:0065009	0.394	regulation of molecular function
GO:0010604	0.388	positive regulation of macromolecule metabolic process
GO:0048519	0.373	negative regulation of biological process
GO:0031325	0.362	positive regulation of cellular metabolic process
GO:1902531	0.357	regulation of intracellular signal transduction
GO:0007275	0.347	multicellular organism development
GO:0007166	0.340	cell surface receptor signaling pathway
GO:0043254	0.329	regulation of protein-containing complex assembly
GO:0051246	0.328	regulation of protein metabolic process
GO:1901186	0.328	positive regulation of ERBB signaling pathway

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.999	membrane
GO:0043227	0.998	membrane-bounded organelle
GO:0005829	0.997	cytosol
GO:0005886	0.976	plasma membrane
GO:0043229	0.974	intracellular organelle
GO:0043231	0.930	intracellular membrane-bounded organelle
GO:0031982	0.848	vesicle
GO:0012505	0.804	endomembrane system
GO:0005576	0.786	extracellular region
GO:0005615	0.733	extracellular space
GO:0070062	0.664	extracellular exosome
GO:0031410	0.532	cytoplasmic vesicle
GO:0031090	0.523	organelle membrane
GO:0030054	0.400	cell junction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:19669	1.000	GTP + H2O = GDP + H(+) + phosphate

[back to server]