StarFunc result for job id P11245

User Input

>input (290 residues)
MDIEAYFERIGYKNSRNKLDLETLTDILEHQIRAVPFENLNMHCGQAMELGLEAIFDHIV
RRNRGGWCLQVNQLLYWALTTIGFQTTMLGGYFYIPPVNKYSTGMVHLLLQVTIDGRNYI
VDAGSGSSSQMWQPLELISGKDQPQVPCIFCLTEERGIWYLDQIRREQYITNKEFLNSHL
LPKKKHQKIYLFTLEPRTIEDFESMNTYLQTSPTSSFITTSFCSLQTPEGVYCLVGFILT
YRKFNYKDNTDLVEFKTLTEEEVEEVLKNIFKISLGRNLVPKPGDGSLTI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P11245	1.000	1.000	1.138E-66	290	1.000	1.000	P11245.pdb.gz	ARY2_HUMAN Arylamine N-acetyltransferase 2 OS=Homo sapiens OX=9606 GN=NAT2 PE=1 SV=2
2	PDB:2pfrA	0.992	0.992	5.582E-61	290	0.997	0.997	2pfrA.pdb.gz	The Crystal Structure of Human N-acetyltransferase 2 in complex with CoA
3	AFDB:P18440	0.997	0.997	2.131E-58	290	0.810	0.810	P18440.pdb.gz	ARY1_HUMAN Arylamine N-acetyltransferase 1 OS=Homo sapiens OX=9606 GN=NAT1 PE=1 SV=2
4	PDB:2pqtA	0.992	0.975	7.963E-56	295	0.810	0.797	2pqtA.pdb.gz
5	AFDB:P50295	0.995	0.995	1.373E-55	290	0.748	0.748	P50295.pdb.gz	ARY2_MOUSE Arylamine N-acetyltransferase 2 OS=Mus musculus OX=10090 GN=Nat2 PE=1 SV=1
6	AFDB:P50294	0.997	0.997	2.207E-55	290	0.721	0.721	P50294.pdb.gz	ARY1_MOUSE Arylamine N-acetyltransferase 1 OS=Mus musculus OX=10090 GN=Nat1 PE=1 SV=1
7	AFDB:P50296	0.996	0.996	7.318E-54	290	0.659	0.659	P50296.pdb.gz	ARY3_MOUSE Arylamine N-acetyltransferase 3 OS=Mus musculus OX=10090 GN=Nat3 PE=2 SV=1
8	AFDB:P77567	0.814	0.839	4.072E-23	281	0.203	0.210	P77567.pdb.gz	NHOA_ECOLI Arylamine N-acetyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=nhoA PE=1 SV=1
9	AFDB:P9WJI5	0.807	0.827	4.639E-22	283	0.248	0.254	P9WJI5.pdb.gz	NAT_MYCTU Arylamine N-acetyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=nat PE=1 SV=1
10	AFDB:Q9HUY3	0.788	0.818	4.981E-21	279	0.210	0.219	Q9HUY3.pdb.gz	Q9HUY3_PSEAE Arylamine N-acetyltransferase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=PA4827 PE=1 SV=1
11	PDB:1w4tA	0.786	0.822	2.047E-20	277	0.210	0.220	1w4tA.pdb.gz
12	AFDB:O87990	0.276	0.211	9.209E-4	393	0.069	0.051	O87990.pdb.gz	O87990_BORBO Putative secreted protein OS=Bordetella bronchiseptica OX=518 GN=BbLPS1.17c PE=4 SV=1
13	AFDB:O14302	0.277	0.109	1.498E-2	886	0.121	0.040	O14302.pdb.gz	CYK3_SCHPO cytokinesis protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cyk3 PE=1 SV=1
14	PDB:6xu4A	0.092	0.078	2.245E-2	389	0.066	0.049	6xu4A.pdb.gz	FGCaMP7, an Improved Version of Fungi-Based Ratiometric Calcium Indicator for In Vivo Visualization of Neuronal Activity.
15	PDB:6ya9A	0.089	0.070	2.382E-2	400	0.062	0.045	6ya9A.pdb.gz	Genetically encoded photo-switchable molecular sensors for optoacoustic and super-resolution imaging.
16	PDB:3ljuX	0.113	0.097	4.855E-2	373	0.076	0.059	3ljuX.pdb.gz	Phosphorylation-independent dual-site binding of the FHA domain of KIF13 mediates phosphoinositide transport via centaurin alpha1.
17	PDB:6hhgA	0.137	0.108	7.805E-2	386	0.072	0.054	6hhgA.pdb.gz	Structural and chemical insights into the covalent-allosteric inhibition of the protein kinase Akt.
18	PDB:6jzcB	0.237	0.266	7.805E-2	253	0.069	0.079	6jzcB.pdb.gz
19	PDB:6gezB	0.092	0.060	8.789E-2	532	0.062	0.034	6gezB.pdb.gz	Dynamic tuning of FRET in a green fluorescent protein biosensor.
20	PDB:6pgvA	0.142	0.221	1.050E-1	152	0.076	0.145	6pgvA.pdb.gz	Structural insights into the activity and regulation of human Josephin-2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P11245	0.0	602	290	0.997	0.997	ARY2_HUMAN Arylamine N-acetyltransferase 2 OS=Homo sapiens OX=9606 GN=NAT2 PE=1 SV=2
2	P18440	1.04e-178	496	290	0.810	0.810	ARY1_HUMAN Arylamine N-acetyltransferase 1 OS=Homo sapiens OX=9606 GN=NAT1 PE=1 SV=2
3	P50295	2.03e-167	467	290	0.748	0.748	ARY2_MOUSE Arylamine N-acetyltransferase 2 OS=Mus musculus OX=10090 GN=Nat2 PE=1 SV=1
4	P50298	8.14e-164	458	290	0.738	0.738	ARY2_RAT Arylamine N-acetyltransferase 2 OS=Rattus norvegicus OX=10116 GN=Nat2 PE=1 SV=1
5	P50297	2.54e-162	454	290	0.745	0.745	ARY1_RAT Arylamine N-acetyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Nat1 PE=1 SV=1
6	P50294	7.89e-159	445	290	0.721	0.721	ARY1_MOUSE Arylamine N-acetyltransferase 1 OS=Mus musculus OX=10090 GN=Nat1 PE=1 SV=1
7	P50296	8.87e-142	402	290	0.659	0.659	ARY3_MOUSE Arylamine N-acetyltransferase 3 OS=Mus musculus OX=10090 GN=Nat3 PE=2 SV=1
8	P9WJI5	1.61e-19	88.2	283	0.248	0.254	NAT_MYCTU Arylamine N-acetyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=nat PE=1 SV=1
9	Q9HUY3	3.14e-12	67.8	279	0.228	0.237	Q9HUY3_PSEAE Arylamine N-acetyltransferase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=PA4827 PE=1 SV=1
10	P77567	1.16e-05	48.1	281	0.221	0.228	NHOA_ECOLI Arylamine N-acetyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=nhoA PE=1 SV=1
11	Q7Z449	0.31	35.0	544	0.107	0.057	CP2U1_HUMAN Cytochrome P450 2U1 OS=Homo sapiens OX=9606 GN=CYP2U1 PE=1 SV=1
12	Q21815	7.6	30.8	552	0.069	0.036	MIG23_CAEEL Nucleoside-diphosphatase mig-23 OS=Caenorhabditis elegans OX=6239 GN=mig-23 PE=1 SV=2
13	P12532	8.9	30.4	417	0.055	0.038	KCRU_HUMAN Creatine kinase U-type, mitochondrial OS=Homo sapiens OX=9606 GN=CKMT1A PE=1 SV=1
14	Q9U485	8.9	30.4	1490	0.062	0.012	Q9U485_DROME Numb-associated kinase OS=Drosophila melanogaster OX=7227 GN=Nak PE=2 SV=1
15	Q9VJ30	9.0	30.4	1488	0.062	0.012	Q9VJ30_DROME Numb-associated kinase, isoform A OS=Drosophila melanogaster OX=7227 GN=Nak PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00797 Acetyltransf_2	1.6e-88	308.1	N-acetyltransferase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000286479

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000342007	0.974	Cytochrome P450 1A2
2	9606.ENSP00000440689	0.971	Cytochrome P450 2E1
3	9606.ENSP00000301141	0.958	Cytochrome P450 2A6
4	9606.ENSP00000353720	0.917	Liver carboxylesterase 1
5	9606.ENSP00000368727	0.913	Xanthine dehydrogenase/oxidase
6	9606.ENSP00000225275	0.912	Myeloperoxidase
7	9606.ENSP00000443194	0.850	Arylamine N-acetyltransferase 1
8	9606.ENSP00000311469	0.807	Glutathione S-transferase Mu 1
9	9606.ENSP00000291577	0.778	ES1 protein homolog, mitochondrial
10	9606.ENSP00000480313	0.778	Belongs to the GATD3 family
11	9606.ENSP00000353820	0.710	Cytochrome P450 2D6
12	9606.ENSP00000337915	0.663	Cytochrome P450 3A4
13	9606.ENSP00000360372	0.660	Cytochrome P450 2C19
14	9606.ENSP00000378972	0.654	Sulfotransferase 1A1
15	9606.ENSP00000260682	0.653	Cytochrome P450 2C9
16	9606.ENSP00000369050	0.648	Cytochrome P450 1A1
17	9606.ENSP00000312304	0.615	Thiopurine S-methyltransferase
18	9606.ENSP00000260970	0.602	Peptidyl-prolyl cis-trans isomerase G
19	9606.ENSP00000385903	0.588	N-alpha-acetyltransferase 60
20	9606.ENSP00000355627	0.568	Angiotensinogen

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004060	1.000	arylamine N-acetyltransferase activity
GO:0005515	0.996	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0042221	0.995	response to chemical
GO:0044237	0.995	cellular metabolic process
GO:0009410	0.981	response to xenobiotic stimulus
GO:0070887	0.979	cellular response to chemical stimulus
GO:0006805	0.967	xenobiotic metabolic process
GO:0071704	0.319	organic substance metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0016020	0.833	membrane
GO:0012505	0.491	endomembrane system
GO:0043231	0.414	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:16613	1.000	acetyl-CoA + an arylamine = an N-acetylarylamine + CoA
EC:2.3.1.5	1.000	arylamine N-acetyltransferase.

[back to server]