StarFunc result for job id P11274

User Input

>input (1271 residues)
MVDPVGFAEAWKAQFPDSEPPRMELRSVGDIEQELERCKASIRRLEQEVNQERFRMIYLQ
TLLAKEKKSYDRQRWGFRRAAQAPDGASEPRASASRPQPAPADGADPPPAEEPEARPDGE
GSPGKARPGTARRPGAAASGERDDRGPPASVAALRSNFERIRKGHGQPGADAEKPFYVNV
EFHHERGLVKVNDKEVSDRISSLGSQAMQMERKKSQHGAGSSVGDASRPPYRGRSSESSC
GVDGDYEDAELNPRFLKDNLIDANGGSRPPWPPLEYQPYQSIYVGGMMEGEGKGPLLRSQ
STSEQEKRLTWPRRSYSPRSFEDCGGGYTPDCSSNENLTSSEEDFSSGQSSRVSPSPTTY
RMFRDKSRSPSQNSQQSFDSSSPPTPQCHKRHRHCPVVVSEATIVGVRKTGQIWPNDGEG
AFHGDADGSFGTPPGYGCAADRAEEQRRHQDGLPYIDDSPSSSPHLSSKGRGSRDALVSG
ALESTKASELDLEKGLEMRKWVLSGILASEETYLSHLEALLLPMKPLKAAATTSQPVLTS
QQIETIFFKVPELYEIHKEFYDGLFPRVQQWSHQQRVGDLFQKLASQLGVYRAFVDNYGV
AMEMAEKCCQANAQFAEISENLRARSNKDAKDPTTKNSLETLLYKPVDRVTRSTLVLHDL
LKHTPASHPDHPLLQDALRISQNFLSSINEEITPRRQSMTVKKGEHRQLLKDSFMVELVE
GARKLRHVFLFTDLLLCTKLKKQSGGKTQQYDCKWYIPLTDLSFQMVDELEAVPNIPLVP
DEELDALKIKISQIKNDIQREKRANKGSKATERLKKKLSEQESLLLLMSPSMAFRVHSRN
GKSYTFLISSDYERAEWRENIREQQKKCFRSFSLTSVELQMLTNSCVKLQTVHSIPLTIN
KEDDESPGLYGFLNVIVHSATGFKQSSNLYCTLEVDSFGYFVNKAKTRVYRDTAEPNWNE
EFEIELEGSQTLRILCYEKCYNKTKIPKEDGESTDRLMGKGQVQLDPQALQDRDWQRTVI
AMNGIEVKLSVKFNSREFSLKRMPSRKQTGVFGVKIAVVTKRERSKVPYIVRQCVEEIER
RGMEEVGIYRVSGVATDIQALKAAFDVNNKDVSVMMSEMDVNAIAGTLKLYFRELPEPLF
TDEFYPNFAEGIALSDPVAKESCMLNLLLSLPEANLLTFLFLLDHLKRVAEKEAVNKMSL
HNLATVFGPTLLRPSEKESKLPANPSQPITMTDSWSLEVMSQVQVLLYFLQLEAIPAPDS
KRQSILFSTEV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P11274	1.000	1.000	0.000	1271	1.000	1.000	P11274.pdb.gz	BCR_HUMAN Breakpoint cluster region protein OS=Homo sapiens OX=9606 GN=BCR PE=1 SV=2
2	AFDB:A0A0G2JTR4	0.517	0.732	5.168E-98	859	0.442	0.654	A0A0G2JTR4.pdb.gz	ABR_RAT Active breakpoint cluster region-related protein OS=Rattus norvegicus OX=10116 GN=Abr PE=1 SV=2
3	AFDB:X2JC00	0.242	0.225	1.122E-61	1404	0.287	0.260	X2JC00.pdb.gz	X2JC00_DROME Rho GTPase activating protein at 1A, isoform E OS=Drosophila melanogaster OX=7227 GN=RhoGAP1A PE=1 SV=1
4	AFDB:Q5VT97	0.229	0.243	3.568E-19	1194	0.158	0.168	Q5VT97.pdb.gz	SYDE2_HUMAN Rho GTPase-activating protein SYDE2 OS=Homo sapiens OX=9606 GN=SYDE2 PE=1 SV=2
5	AFDB:Q54YZ6	0.208	0.216	1.016E-16	1218	0.099	0.103	Q54YZ6.pdb.gz	Q54YZ6_DICDI Uncharacterized protein OS=Dictyostelium discoideum OX=44689 GN=gxcA PE=4 SV=1
6	PDB:7rx9A	0.140	0.385	6.658E-13	432	0.066	0.194	7rx9A.pdb.gz
7	AFDB:Q8IQ97	0.191	0.185	4.530E-12	1311	0.116	0.112	Q8IQ97.pdb.gz	Q8IQ97_DROME Pebble, isoform B OS=Drosophila melanogaster OX=7227 GN=pbl PE=4 SV=1
8	PDB:4mt6A	0.201	0.571	5.028E-12	389	0.051	0.167	4mt6A.pdb.gz
9	AFDB:P34288	0.141	0.114	1.365E-11	1605	0.143	0.113	P34288.pdb.gz	PAC1_CAEEL GTPase-activating protein pac-1 OS=Caenorhabditis elegans OX=6239 GN=pac-1 PE=1 SV=4
10	AFDB:Q12774	0.196	0.160	6.509E-11	1597	0.115	0.091	Q12774.pdb.gz	ARHG5_HUMAN Rho guanine nucleotide exchange factor 5 OS=Homo sapiens OX=9606 GN=ARHGEF5 PE=1 SV=3
11	PDB:3cxlA	0.143	0.436	1.651E-10	402	0.058	0.184	3cxlA.pdb.gz	Crystal structure of human chimerin 1 (CHN1).
12	PDB:5c2kA	0.132	0.425	1.801E-9	382	0.049	0.162	5c2kA.pdb.gz	Structural basis of G-protein target alternation of MgcRacGAP by phospholylation
13	PDB:1xa6A	0.144	0.445	3.126E-9	399	0.050	0.160	1xa6A.pdb.gz	Structural mechanism for lipid activation of the Rac-specific GAP, beta2-chimaerin.
14	PDB:6r3vA	0.134	0.785	4.118E-9	198	0.043	0.278	6r3vA.pdb.gz	A GAP-GTPase-GDP-PiIntermediate Crystal Structure Analyzed by DFT Shows GTP Hydrolysis Involves Serial Proton Transfers.
15	PDB:5jcpA	0.125	0.413	5.650E-8	361	0.038	0.133	5jcpA.pdb.gz	Structural Basis for the Specific Recognition of RhoA by the Dual GTPase-activating Protein ARAP3
16	AFDB:P39083	0.151	0.188	2.116E-7	1007	0.127	0.160	P39083.pdb.gz	RGA1_YEAST Rho-type GTPase-activating protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RGA1 PE=1 SV=1
17	PDB:1cjyA	0.089	0.167	4.266E-7	633	0.043	0.087	1cjyA.pdb.gz	Crystal structure of human cytosolic phospholipase A2 reveals a novel topology and catalytic mechanism.
18	AFDB:Q06407	0.148	0.183	5.552E-7	1009	0.121	0.153	Q06407.pdb.gz	RGA2_YEAST Rho-type GTPase-activating protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RGA2 PE=1 SV=1
19	PDB:4gouA	0.135	0.303	2.681E-6	507	0.040	0.101	4gouA.pdb.gz
20	PDB:5a50A	0.078	0.546	5.591E-6	165	0.023	0.176	5a50A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JTR4	0.0	1169	859	0.448	0.664	ABR_RAT Active breakpoint cluster region-related protein OS=Rattus norvegicus OX=10116 GN=Abr PE=1 SV=2
2	F1LXF1	0.0	2380	1270	0.939	0.940	BCR_RAT Breakpoint cluster region protein OS=Rattus norvegicus OX=10116 GN=Bcr PE=1 SV=4
3	P11274	0.0	2638	1271	1.000	1.000	BCR_HUMAN Breakpoint cluster region protein OS=Homo sapiens OX=9606 GN=BCR PE=1 SV=2
4	Q12979	0.0	1172	859	0.451	0.667	ABR_HUMAN Active breakpoint cluster region-related protein OS=Homo sapiens OX=9606 GN=ABR PE=1 SV=2
5	Q5SSL4	0.0	1171	859	0.450	0.666	ABR_MOUSE Active breakpoint cluster region-related protein OS=Mus musculus OX=10090 GN=Abr PE=1 SV=1
6	Q6PAJ1	0.0	2345	1270	0.939	0.940	BCR_MOUSE Breakpoint cluster region protein OS=Mus musculus OX=10090 GN=Bcr PE=1 SV=3
7	X2JC00	1.65e-132	442	1404	0.226	0.204	X2JC00_DROME Rho GTPase activating protein at 1A, isoform E OS=Drosophila melanogaster OX=7227 GN=RhoGAP1A PE=1 SV=1
8	Q29QE1	1.69e-132	442	1403	0.226	0.205	Q29QE1_DROME GH15984p OS=Drosophila melanogaster OX=7227 GN=RhoGAP1A PE=1 SV=1
9	X2J9V9	1.99e-132	442	1402	0.226	0.205	X2J9V9_DROME Rho GTPase activating protein at 1A, isoform D OS=Drosophila melanogaster OX=7227 GN=RhoGAP1A PE=1 SV=1
10	Q8MSA6	6.26e-95	317	531	0.161	0.384	Q8MSA6_DROME LD45876p OS=Drosophila melanogaster OX=7227 GN=RhoGAP1A PE=2 SV=1
11	C1C560	1.09e-78	281	903	0.139	0.196	C1C560_DROME MIP02960p OS=Drosophila melanogaster OX=7227 GN=RhoGAP1A PE=1 SV=1
12	O96833	1.60e-74	263	658	0.132	0.255	O96833_DROME EG:23E12.2 protein OS=Drosophila melanogaster OX=7227 GN=RhoGAP1A PE=4 SV=1
13	Q6W456	6.88e-52	187	317	0.094	0.375	Q6W456_DROME RhoGAP1A (Fragment) OS=Drosophila melanogaster OX=7227 GN=RhoGAP1A PE=4 SV=1
14	Q6W453	7.01e-52	187	317	0.094	0.375	Q6W453_DROME RhoGAP1A (Fragment) OS=Drosophila melanogaster OX=7227 GN=RhoGAP1A PE=4 SV=1
15	Q6W437	7.79e-52	187	317	0.094	0.375	Q6W437_DROME RhoGAP1A (Fragment) OS=Drosophila melanogaster OX=7227 GN=RhoGAP1A PE=4 SV=1
16	Q6W434	4.68e-51	185	317	0.093	0.372	Q6W434_DROME RhoGAP1A (Fragment) OS=Drosophila melanogaster OX=7227 GN=RhoGAP1A PE=4 SV=1
17	Q6W436	1.66e-50	183	317	0.091	0.366	Q6W436_DROME RhoGAP1A (Fragment) OS=Drosophila melanogaster OX=7227 GN=RhoGAP1A PE=4 SV=1
18	Q6W435	9.52e-50	181	317	0.087	0.350	Q6W435_DROME RhoGAP1A (Fragment) OS=Drosophila melanogaster OX=7227 GN=RhoGAP1A PE=4 SV=1
19	Q9V9S7	2.33e-38	159	1866	0.087	0.059	SYDE_DROME Rho GTPase-activating protein 100F OS=Drosophila melanogaster OX=7227 GN=RhoGAP100F PE=1 SV=2
20	Q6TLK4	3.10e-35	147	869	0.060	0.087	RHG27_RAT Rho GTPase-activating protein 27 OS=Rattus norvegicus OX=10116 GN=Arhgap27 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09036 Bcr-Abl_Oligo	2.7e-36	134.7	Bcr-Abl oncoprotein oligomerisation domain
2	PF00168 C2	0.0069	28.0	C2 domain
3	PF16453 IQ_SEC7_PH	9.4	17.6	PH domain
4	PF00169 PH	10	18.0	PH domain
5	PF19057 PH_19	0.00027	32.1	PH domain
6	PF15405 PH_5	1e+02	14.4	Pleckstrin homology domain
7	PF00620 RhoGAP	9.7e-45	163.5	RhoGAP domain
8	PF00621 RhoGEF	1.1e-31	121.9	RhoGEF domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000303507

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000376345	0.998	Growth factor receptor-bound protein 2
2	9606.ENSP00000361423	0.997	Tyrosine-protein kinase ABL1
3	9606.ENSP00000346300	0.984	Crk-like protein
4	9606.ENSP00000401303	0.963	SHC-transforming protein 1
5	9606.ENSP00000371067	0.955	Tyrosine-protein kinase JAK2
6	9606.ENSP00000387784	0.952	Son of sevenless homolog 1
7	9606.ENSP00000428056	0.952	Phosphatidylinositol 3-kinase regulatory subunit alpha
8	9606.ENSP00000348461	0.951	Ras-related C3 botulinum toxin substrate 1
9	9606.ENSP00000391592	0.951	Tyrosine-protein phosphatase non-receptor type 6
10	9606.ENSP00000400175	0.951	Transforming protein RhoA
11	9606.ENSP00000293328	0.944	Signal transducer and activator of transcription 5B
12	9606.ENSP00000341208	0.944	Signal transducer and activator of transcription 5A
13	9606.ENSP00000428924	0.941	Tyrosine-protein kinase Lyn
14	9606.ENSP00000405338	0.930	Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1
15	9606.ENSP00000274376	0.926	Ras GTPase-activating protein 1
16	9606.ENSP00000361021	0.926	Phosphatase and tensin homolog
17	9606.ENSP00000233668	0.925	Docking protein 1
18	9606.ENSP00000437940	0.925	B-lymphocyte antigen CD19
19	9606.ENSP00000244007	0.924	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1
20	9606.ENSP00000354558	0.924	Serine/threonine-protein kinase mTOR

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005096	1.000	GTPase activator activity
GO:0003824	0.989	catalytic activity
GO:0140678	0.976	molecular function inhibitor activity
GO:0005085	0.969	guanyl-nucleotide exchange factor activity
GO:0140096	0.960	catalytic activity, acting on a protein
GO:0016740	0.934	transferase activity
GO:0004713	0.908	protein tyrosine kinase activity
GO:0019899	0.786	enzyme binding
GO:0004674	0.776	protein serine/threonine kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.997	biological regulation
GO:0009987	0.992	cellular process
GO:0050896	0.991	response to stimulus
GO:0050794	0.991	regulation of cellular process
GO:0007154	0.956	cell communication
GO:0051716	0.954	cellular response to stimulus
GO:0023052	0.948	signaling
GO:0071704	0.929	organic substance metabolic process
GO:0044237	0.910	cellular metabolic process
GO:0044238	0.909	primary metabolic process
GO:0048583	0.898	regulation of response to stimulus
GO:0010646	0.891	regulation of cell communication
GO:0007165	0.885	signal transduction
GO:0023051	0.884	regulation of signaling
GO:0007166	0.883	cell surface receptor signaling pathway
GO:0043170	0.872	macromolecule metabolic process
GO:0006807	0.869	nitrogen compound metabolic process
GO:0032502	0.845	developmental process
GO:1901564	0.845	organonitrogen compound metabolic process
GO:0006468	0.833	protein phosphorylation
GO:0071840	0.815	cellular component organization or biogenesis
GO:0048518	0.815	positive regulation of biological process
GO:0009966	0.770	regulation of signal transduction
GO:0048856	0.758	anatomical structure development
GO:0048522	0.674	positive regulation of cellular process
GO:0065009	0.634	regulation of molecular function
GO:0016043	0.633	cellular component organization
GO:0032501	0.558	multicellular organismal process
GO:0019222	0.529	regulation of metabolic process
GO:0050790	0.511	regulation of catalytic activity
GO:0048519	0.491	negative regulation of biological process
GO:0044093	0.449	positive regulation of molecular function
GO:0035556	0.432	intracellular signal transduction
GO:1902531	0.416	regulation of intracellular signal transduction
GO:0042221	0.411	response to chemical
GO:0048523	0.405	negative regulation of cellular process
GO:0060255	0.393	regulation of macromolecule metabolic process
GO:0031323	0.364	regulation of cellular metabolic process
GO:0070887	0.345	cellular response to chemical stimulus
GO:0007167	0.339	enzyme-linked receptor protein signaling pathway
GO:0048869	0.328	cellular developmental process
GO:0007169	0.327	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0030154	0.317	cell differentiation
GO:0048584	0.309	positive regulation of response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043226	1.000	organelle
GO:0005829	1.000	cytosol
GO:0005886	0.997	plasma membrane
GO:0043227	0.994	membrane-bounded organelle
GO:0043229	0.985	intracellular organelle
GO:0045202	0.965	synapse
GO:0032991	0.963	protein-containing complex
GO:0043232	0.955	intracellular non-membrane-bounded organelle
GO:0098794	0.948	postsynapse
GO:0098978	0.947	glutamatergic synapse
GO:0005576	0.945	extracellular region
GO:0098984	0.932	neuron to neuron synapse
GO:0099572	0.928	postsynaptic specialization
GO:0014069	0.918	postsynaptic density
GO:0005615	0.882	extracellular space
GO:0031982	0.880	vesicle
GO:0070062	0.830	extracellular exosome
GO:0043231	0.757	intracellular membrane-bounded organelle
GO:0099092	0.314	postsynaptic density, intracellular component

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.934	Transferases.
RHEA:10596	0.908	ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein]

[back to server]