StarFunc result for job id P11277

User Input

>input (2137 residues)
MTSATEFENVGNQPPYSRINARWDAPDDELDNDNSSARLFERSRIKALADEREVVQKKTF
TKWVNSHLARVSCRITDLYKDLRDGRMLIKLLEVLSGEMLPKPTKGKMRIHCLENVDKAL
QFLKEQRVHLENMGSHDIVDGNHRLVLGLIWTIILRFQIQDIVVQTQEGRETRSAKDALL
LWCQMKTAGYPHVNVTNFTSSWKDGLAFNALIHKHRPDLIDFDKLKDSNARHNLEHAFNV
AERQLGIIPLLDPEDVFTENPDEKSIITYVVAFYHYFSKMKVLAVEGKRVGKVIDHAIET
EKMIEKYSGLASDLLTWIEQTITVLNSRKFANSLTGVQQQLQAFSTYRTVEKPPKFQEKG
NLEVLLFTIQSRMRANNQKVYTPHDGKLVSDINRAWESLEEAEYRRELALRNELIRQEKL
EQLARRFDRKAAMRETWLSENQRLVAQDNFGYDLAAVEAAKKKHEAIETDTAAYEERVRA
LEDLAQELEKENYHDQKRITARKDNILRLWSYLQELLQSRRQRLETTLALQKLFQDMLHS
IDWMDEIKAHLLSAEFGKHLLEVEDLLQKHKLMEADIAIQGDKVKAITAATLKFTEGKGY
QPCDPQVIQDRISHLEQCFEELSNMAAGRKAQLEQSKRLWKFFWEMDEAESWIKEKEQIY
SSLDYGKDLTSVLILQRKHKAFEDELRGLDAHLEQIFQEAHGMVARKQFGHPQIEARIKE
VSAQWDQLKDLAAFCKKNLQDAENFFQFQGDADDLKAWLQDAHRLLSGEDVGQDEGATRA
LGKKHKDFLEELEESRGVMEHLEQQAQGFPEEFRDSPDVTHRLQALRELYQQVVAQADLR
QQRLQEALDLYTVFGETDACELWMGEKEKWLAEMEMPDTLEDLEVVQHRFDILDQEMKTL
MTQIDGVNLAANSLVESGHPRSREVKQYQDHLNTRWQAFQTLVSERREAVDSALRVHNYC
VDCEETSKWITDKTKVVESTKDLGRDLAGIIAIQRKLSGLERDVAAIQARVDALERESQQ
LMDSHPEQKEDIGQRQKHLEELWQGLQQSLQGQEDLLGEVSQLQAFLQDLDDFQAWLSIT
QKAVASEDMPESLPEAEQLLQQHAGIKDEIDGHQDSYQRVKESGEKVIQGQTDPEYLLLG
QRLEGLDTGWNALGRMWESRSHTLAQCLGFQEFQKDAKQAEAILSNQEYTLAHLEPPDSL
EAAEAGIRKFEDFLGSMENNRDKVLSPVDSGNKLVAEGNLYSDKIKEKVQLIEDRHRKNN
EKAQEASVLLRDNLELQNFLQNCQELTLWINDKLLTSQDVSYDEARNLHNKWLKHQAFVA
ELASHEGWLENIDAEGKQLMDEKPQFTALVSQKLEALHRLWDELQATTKEKTQHLSAARS
SDLRLQTHADLNKWISAMEDQLRSDDPGKDLTSVNRMLAKLKRVEDQVNVRKEELGELFA
QVPSMGEEGGDADLSIEKRFLDLLEPLGRRKKQLESSRAKLQISRDLEDETLWVEERLPL
AQSADYGTNLQTVQLFMKKNQTLQNEILGHTPRVEDVLQRGQQLVEAAEIDCQDLEERLG
HLQSSWDRLREAAAGRLQRLRDANEAQQYYLDADEAEAWIGEQELYVISDEIPKDEEGAI
VMLKRHLRQQRAVEDYGRNIKQLASRAQGLLSAGHPEGEQIIRLQGQVDKHYAGLKDVAE
ERKRKLENMYHLFQLKRETDDLEQWISEKELVASSPEMGQDFDHVTLLRDKFRDFARETG
AIGQERVDNVNAFIERLIDAGHSEAATIAEWKDGLNEMWADLLELIDTRMQLLAASYDLH
RYFYTGAEILGLIDEKHRELPEDVGLDASTAESFHRVHTAFERELHLLGVQVQQFQDVAT
RLQTAYAGEKAEAIQNKEQEVSAAWQALLDACAGRRTQLVDTADKFRFFSMARDLLSWME
SIIRQIETQERPRDVSSVELLMKYHQGINAEIETRSKNFSACLELGESLLQRQHQASEEI
REKLQQVMSRRKEMNEKWEARWERLRMLLEVCQFSRDASVAEAWLIAQEPYLASGDFGHT
VDSVEKLIKRHEAFEKSTASWAERFAALEKPTTLELKERQIAERPAEETGPQEEEGETAG
EAPVSHHAATERTSPVSLWSRLSSSWESLQPEPSHPY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E0AHA7	0.234	0.218	0.000	2326	0.462	0.424	E0AHA7.pdb.gz	E0AHA7_CAEEL Spectrin beta chain OS=Caenorhabditis elegans OX=6239 GN=unc-70 PE=1 SV=1
2	AFDB:F1QQE5	0.419	0.390	0.000	2357	0.641	0.581	F1QQE5.pdb.gz	F1QQE5_DANRE Spectrin beta chain OS=Danio rerio OX=7955 GN=wu:fa09g12 PE=1 SV=1
3	AFDB:O15020	0.441	0.402	0.000	2390	0.541	0.484	O15020.pdb.gz	SPTN2_HUMAN Spectrin beta chain, non-erythrocytic 2 OS=Homo sapiens OX=9606 GN=SPTBN2 PE=1 SV=3
4	AFDB:P11277	1.000	1.000	0.000	2137	1.000	1.000	P11277.pdb.gz	SPTB1_HUMAN Spectrin beta chain, erythrocytic OS=Homo sapiens OX=9606 GN=SPTB PE=1 SV=5
5	AFDB:Q00963	0.177	0.169	0.000	2291	0.491	0.458	Q00963.pdb.gz	SPTCB_DROME Spectrin beta chain OS=Drosophila melanogaster OX=7227 GN=beta-Spec PE=1 SV=2
6	AFDB:Q01082	0.373	0.343	0.000	2364	0.607	0.549	Q01082.pdb.gz	SPTB2_HUMAN Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTBN1 PE=1 SV=2
7	AFDB:Q9H254	0.349	0.300	0.000	2564	0.485	0.404	Q9H254.pdb.gz	SPTN4_HUMAN Spectrin beta chain, non-erythrocytic 4 OS=Homo sapiens OX=9606 GN=SPTBN4 PE=1 SV=2
8	AFDB:F1R446	0.142	0.124	2.085E-64	2480	0.230	0.198	F1R446.pdb.gz
9	AFDB:P07751	0.183	0.159	1.971E-61	2477	0.218	0.188	P07751.pdb.gz	SPTN1_CHICK Spectrin alpha chain, non-erythrocytic 1 OS=Gallus gallus OX=9031 GN=SPTAN1 PE=1 SV=3
10	AFDB:P13395	0.181	0.161	1.963E-60	2415	0.211	0.187	P13395.pdb.gz	SPTCA_DROME Spectrin alpha chain OS=Drosophila melanogaster OX=7227 GN=alpha-Spec PE=1 SV=2
11	PDB:4d1eA	0.120	0.267	6.734E-31	859	0.117	0.292	4d1eA.pdb.gz
12	PDB:1sjjA	0.118	0.240	4.678E-27	863	0.122	0.302	1sjjA.pdb.gz
13	PDB:7mqaSP	0.043	0.039	2.431E-6	2485	0.139	0.119	7mqaSP.pdb.gz	Nucleolar maturation of the human small subunit processome.
14	PDB:7mqaLM	0.044	0.045	5.786E-6	2041	0.116	0.122	7mqaLM.pdb.gz	Nucleolar maturation of the human small subunit processome.
15	PDB:7sx8D	0.088	0.361	1.017E-5	448	0.026	0.123	7sx8D.pdb.gz	Structural mechanism for bidirectional actin cross-linking by T-plastin.
16	PDB:7mq8LM	0.047	0.049	1.949E-5	2005	0.109	0.117	7mq8LM.pdb.gz	Nucleolar maturation of the human small subunit processome.
17	PDB:7ajuUT	0.056	0.052	3.734E-5	2313	0.129	0.119	7ajuUT.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
18	PDB:7sqcR1	0.048	0.049	4.441E-5	2080	0.109	0.112	7sqcR1.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
19	PDB:7sglA	0.062	0.045	7.473E-5	3852	0.133	0.074	7sglA.pdb.gz	Autophosphorylation transforms DNA-PK from protecting to processing DNA ends.
20	PDB:7nfeA	0.048	0.035	1.940E-4	3585	0.127	0.076	7nfeA.pdb.gz	Cryo-EM of NHEJ supercomplexes provides insights into DNA repair.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JZY6	2599	2152	0.585	0.581	A0A0G2JZY6_RAT Spectrin beta chain OS=Rattus norvegicus OX=10116 GN=Sptbn1 PE=1 SV=2
2	A0A0G2K677	1903	2561	0.482	0.402	A0A0G2K677_RAT Spectrin beta chain OS=Rattus norvegicus OX=10116 GN=Sptbn4 PE=1 SV=1
3	A0A140UHX6	3902	2117	0.898	0.907	A0A140UHX6_RAT Spectrin beta chain OS=Rattus norvegicus OX=10116 GN=Sptb PE=1 SV=2
4	A0A8I6ASR7	1901	2542	0.482	0.405	A0A8I6ASR7_RAT Spectrin beta chain OS=Rattus norvegicus OX=10116 GN=Sptbn4 PE=3 SV=1
5	A0A8I6AWM3	3899	2329	0.898	0.824	A0A8I6AWM3_RAT Spectrin beta chain OS=Rattus norvegicus OX=10116 GN=Sptb PE=1 SV=1
6	A0A8I6G9M6	3883	2325	0.895	0.822	A0A8I6G9M6_RAT Spectrin beta chain OS=Rattus norvegicus OX=10116 GN=Sptb PE=1 SV=1
7	A4QPE4	909	934	0.204	0.466	A4QPE4_HUMAN SPTBN2 protein OS=Homo sapiens OX=9606 GN=SPTBN2 PE=1 SV=1
8	E0AHA7	1920	2326	0.462	0.425	E0AHA7_CAEEL Spectrin beta chain OS=Caenorhabditis elegans OX=6239 GN=unc-70 PE=1 SV=1
9	E9PX29	1907	2561	0.482	0.402	E9PX29_MOUSE Spectrin beta chain OS=Mus musculus OX=10090 GN=Sptbn4 PE=1 SV=1
10	E9PZC2	698	1241	0.178	0.306	E9PZC2_MOUSE Spectrin beta, non-erythrocytic 4 OS=Mus musculus OX=10090 GN=Sptbn4 PE=1 SV=1
11	F1QQE5	2769	2357	0.631	0.572	F1QQE5_DANRE Spectrin beta chain OS=Danio rerio OX=7955 GN=wu:fa09g12 PE=1 SV=1
12	F6W8M4	2257	2390	0.541	0.484	F6W8M4_MACMU Spectrin beta chain OS=Macaca mulatta OX=9544 GN=SPTBN2 PE=3 SV=3
13	F7HAE6	767	3697	0.287	0.166	F7HAE6_MACMU Spectrin beta, non-erythrocytic 5 OS=Macaca mulatta OX=9544 GN=SPTBN5 PE=3 SV=3
14	G3V6S0	2653	2361	0.598	0.541	G3V6S0_RAT Spectrin beta chain OS=Rattus norvegicus OX=10116 GN=Sptbn1 PE=1 SV=4
15	G5EG85	1947	2257	0.472	0.447	G5EG85_CAEEL Spectrin beta chain OS=Caenorhabditis elegans OX=6239 GN=unc-70 PE=1 SV=1
16	O15020	2262	2390	0.534	0.477	SPTN2_HUMAN Spectrin beta chain, non-erythrocytic 2 OS=Homo sapiens OX=9606 GN=SPTBN2 PE=1 SV=3
17	P11277	4374	2137	1.000	1.000	SPTB1_HUMAN Spectrin beta chain, erythrocytic OS=Homo sapiens OX=9606 GN=SPTB PE=1 SV=5
18	P15508	3933	2128	0.905	0.908	SPTB1_MOUSE Spectrin beta chain, erythrocytic OS=Mus musculus OX=10090 GN=Sptb PE=1 SV=4
19	Q00963	2055	2291	0.489	0.456	SPTCB_DROME Spectrin beta chain OS=Drosophila melanogaster OX=7227 GN=beta-Spec PE=1 SV=2
20	Q01082	2665	2364	0.599	0.541	SPTB2_HUMAN Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTBN1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11971 CAMSAP_CH	2.1e-06	38.8	CAMSAP CH domain
2	PF00307 CH	1.6e-49	178.0	Calponin homology (CH) domain
3	PF09828 Chrome_Resist	8.6e+02	11.8	Chromate resistance exported protein
4	PF16566 CREPT	33	16.0	Cell-cycle alteration and expression-elevated protein in tumour
5	PF06103 DUF948	1.4e+02	14.1	Bacterial protein of unknown function (DUF948)
6	PF05440 MtrB	1.1e+02	14.6	Tetrahydromethanopterin S-methyltransferase subunit B
7	PF00435 Spectrin	2.9e-295	968.0	Spectrin repeat
8	PF17489 Tnp_22_trimer	4.1e+02	12.7	L1 transposable element trimerization domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000451752

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000265709	0.997	Ankyrin-1
2	9606.ENSP00000357129	0.992	Spectrin alpha chain, erythrocytic 1
3	9606.ENSP00000361824	0.942	Spectrin alpha chain, non-erythrocytic 1
4	9606.ENSP00000362680	0.909	Proto-oncogene tyrosine-protein kinase Src
5	9606.ENSP00000256078	0.905	GTPase KRas
6	9606.ENSP00000358548	0.905	GTPase NRas
7	9606.ENSP00000407586	0.905	GTPase HRas
8	9606.ENSP00000480132	0.896	Neural cell adhesion molecule 1
9	9606.ENSP00000300215	0.873	Erythrocyte membrane protein band 4.2
10	9606.ENSP00000280772	0.805	Ankyrin-3
11	9606.ENSP00000349588	0.797	Ankyrin-2
12	9606.ENSP00000345259	0.795	Protein 4.1
13	9606.ENSP00000357516	0.790	Tropomyosin alpha-3 chain
14	9606.ENSP00000431813	0.778	Cysteine and glycine-rich protein 3
15	9606.ENSP00000317790	0.765	Spectrin beta, non-erythrocytic 5
16	9606.ENSP00000338481	0.753	Band 4.1-like protein 2
17	9606.ENSP00000263373	0.752	Spectrin beta chain, non-erythrocytic 4
18	9606.ENSP00000357177	0.743	Rho guanine nucleotide exchange factor 11
19	9606.ENSP00000432568	0.742	Spectrin beta chain, non-erythrocytic 2
20	9606.ENSP00000344786	0.741	Neurofascin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0051015	0.999	actin filament binding
GO:0030506	0.940	ankyrin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0016043	0.963	cellular component organization
GO:0034330	0.536	cell junction organization
GO:0032502	0.535	developmental process
GO:0048856	0.519	anatomical structure development
GO:0065007	0.460	biological regulation
GO:0051179	0.459	localization
GO:0051234	0.444	establishment of localization
GO:0006810	0.388	transport
GO:0050789	0.381	regulation of biological process
GO:0050794	0.328	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	0.997	cellular anatomical entity
GO:0016020	0.991	membrane
GO:0071944	0.989	cell periphery
GO:0030054	0.987	cell junction
GO:0005622	0.987	intracellular anatomical structure
GO:0005886	0.984	plasma membrane
GO:0005737	0.981	cytoplasm
GO:0043229	0.980	intracellular organelle
GO:0043228	0.975	non-membrane-bounded organelle
GO:0045202	0.971	synapse
GO:0043232	0.967	intracellular non-membrane-bounded organelle
GO:0098978	0.963	glutamatergic synapse
GO:0005856	0.860	cytoskeleton
GO:0043227	0.813	membrane-bounded organelle
GO:0005829	0.786	cytosol
GO:0032991	0.779	protein-containing complex
GO:0043231	0.749	intracellular membrane-bounded organelle
GO:0098794	0.637	postsynapse
GO:0008091	0.381	spectrin
GO:0014731	0.380	spectrin-associated cytoskeleton
GO:0009986	0.358	cell surface

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]