StarFunc result for job id P11310

User Input

>input (421 residues)
MAAGFGRCCRVLRSISRFHWRSQHTKANRQREPGLGFSFEFTEQQKEFQATARKFAREEI
IPVAAEYDKTGEYPVPLIRRAWELGLMNTHIPENCGGLGLGTFDACLISEELAYGCTGVQ
TAIEGNSLGQMPIIIAGNDQQKKKYLGRMTEEPLMCAYCVTEPGAGSDVAGIKTKAEKKG
DEYIINGQKMWITNGGKANWYFLLARSDPDPKAPANKAFTGFIVEADTPGIQIGRKELNM
GQRCSDTRGIVFEDVKVPKENVLIGDGAGFKVAMGAFDKTRPVVAAGAVGLAQRALDEAT
KYALERKTFGKLLVEHQAISFMLAEMAMKVELARMSYQRAAWEVDSGRRNTYYASIAKAF
AGDIANQLATDAVQILGGNGFNTEYPVEKLMRDAKIYQIYEGTSQIQRLIVAREHIDKYK
N

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0S2Z366	0.962	0.962	1.776E-66	421	1.000	1.000	A0A0S2Z366.pdb.gz	A0A0S2Z366_HUMAN Medium-chain specific acyl-CoA dehydrogenase, mitochondrial (Fragment) OS=Homo sapiens OX=9606 GN=ACADM PE=2 SV=1
2	AFDB:Q5T4U5	0.928	0.862	1.229E-62	454	0.957	0.888	Q5T4U5.pdb.gz	Q5T4U5_HUMAN Medium-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=ACADM PE=1 SV=1
3	AFDB:P08503	0.929	0.929	2.497E-62	421	0.865	0.865	P08503.pdb.gz	ACADM_RAT Medium-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Acadm PE=1 SV=1
4	PDB:2a1tC	0.919	0.997	3.700E-60	388	0.922	1.000	2a1tC.pdb.gz	Stabilization of Non-productive Conformations Underpins Rapid Electron Transfer to Electron-transferring Flavoprotein
5	AFDB:Q9VSA3	0.918	0.922	2.670E-54	419	0.677	0.680	Q9VSA3.pdb.gz	ACADM_DROME Medium-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Drosophila melanogaster OX=7227 GN=Mcad PE=1 SV=1
6	AFDB:Q22347	0.916	0.925	1.385E-47	417	0.580	0.585	Q22347.pdb.gz	ACADM_CAEEL Probable medium-chain specific acyl-CoA dehydrogenase 10, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=acdh-10 PE=2 SV=1
7	PDB:1jqiA	0.888	0.973	2.566E-36	384	0.352	0.385	1jqiA.pdb.gz	Crystal structure of rat short chain acyl-CoA dehydrogenase complexed with acetoacetyl-CoA: comparison with other acyl-CoA dehydrogenases.
8	AFDB:P9WQG1	0.875	0.947	2.083E-35	389	0.366	0.396	P9WQG1.pdb.gz	ACDP_MYCTU Probable acyl-CoA dehydrogenase FadE25 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=fadE25 PE=1 SV=1
9	AFDB:Q3ZBF6	0.889	0.908	2.638E-35	412	0.371	0.379	Q3ZBF6.pdb.gz	ACADS_BOVIN Short-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Bos taurus OX=9913 GN=ACADS PE=1 SV=1
10	AFDB:Q2LQP0	0.884	0.968	9.457E-35	384	0.356	0.391	Q2LQP0.pdb.gz	CHCOA_SYNAS Cyclohexane-1-carbonyl-CoA dehydrogenase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=SYN_02586 PE=1 SV=1
11	AFDB:E5KSD5	0.888	0.908	1.833E-34	412	0.344	0.352	E5KSD5.pdb.gz	E5KSD5_HUMAN Acyl-Coenzyme A dehydrogenase, C-2 to C-3 short chain OS=Homo sapiens OX=9606 GN=ACADS PE=3 SV=1
12	AFDB:G3KIM8	0.882	0.942	2.015E-34	394	0.333	0.355	G3KIM8.pdb.gz	ACRC_ANAPI Acryloyl-CoA reductase (NADH) OS=Anaerotignum propionicum OX=28446 GN=acrC PE=1 SV=1
13	PDB:1ivhA	0.871	0.946	7.578E-33	387	0.299	0.326	1ivhA.pdb.gz	Structure of human isovaleryl-CoA dehydrogenase at 2.6 A resolution: structural basis for substrate specificity,.
14	PDB:1rx0A	0.866	0.948	1.055E-32	384	0.302	0.331	1rx0A.pdb.gz	Structures of Isobutyryl-CoA Dehydrogenase and Enzyme-Product Complex: COMPARISON WITH ISOVALERYL- AND SHORT-CHAIN ACYL-COA DEHYDROGENASES.
15	PDB:6fahC	0.860	0.953	2.314E-30	379	0.335	0.372	6fahC.pdb.gz	Molecular basis of the flavin-based electron-bifurcating caffeyl-CoA reductase reaction.
16	PDB:7s7gA	0.837	0.623	1.654E-27	571	0.306	0.226	7s7gA.pdb.gz	Crystal Structure Analysis of Human VLCAD
17	PDB:2ix6A	0.833	0.842	2.918E-27	416	0.249	0.252	2ix6A.pdb.gz	Controlling Electron Transfer in Acyl-Coa Oxidases and Dehydrogenases: A Structural View.
18	PDB:6af6A	0.865	0.948	3.411E-26	383	0.235	0.258	6af6A.pdb.gz	Crystal Structure of PigA: A Prolyl Thioester-Oxidizing Enzyme in Prodigiosin Biosynthesis.
19	PDB:2r0mA	0.843	0.908	5.220E-26	390	0.247	0.267	2r0mA.pdb.gz	The effect of a Glu370Asp mutation in glutaryl-CoA dehydrogenase on proton transfer to the dienolate intermediate.
20	PDB:3d9dA	0.808	0.789	1.276E-22	432	0.226	0.220	3d9dA.pdb.gz	Crystal structures of intermediates in the nitroalkane oxidase reaction.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0S2Z366	0.0	874	421	1.000	1.000	A0A0S2Z366_HUMAN Medium-chain specific acyl-CoA dehydrogenase, mitochondrial (Fragment) OS=Homo sapiens OX=9606 GN=ACADM PE=2 SV=1
2	B7Z9I1	0.0	788	385	0.907	0.992	B7Z9I1_HUMAN Medium-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 PE=1 SV=1
3	P08503	0.0	776	421	0.865	0.865	ACADM_RAT Medium-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Acadm PE=1 SV=1
4	P11310	0.0	874	421	1.000	1.000	ACADM_HUMAN Medium-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=ACADM PE=1 SV=1
5	P45952	0.0	789	421	0.879	0.879	ACADM_MOUSE Medium-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Acadm PE=1 SV=1
6	Q5T4U5	0.0	858	454	1.000	0.927	Q5T4U5_HUMAN Medium-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=ACADM PE=1 SV=1
7	Q9VSA3	0.0	605	419	0.679	0.683	ACADM_DROME Medium-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Drosophila melanogaster OX=7227 GN=Mcad PE=1 SV=1
8	Q22347	1.46e-180	511	417	0.572	0.578	ACADM_CAEEL Probable medium-chain specific acyl-CoA dehydrogenase 10, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=acdh-10 PE=2 SV=1
9	P9WQG1	8.49e-97	296	389	0.368	0.398	ACDP_MYCTU Probable acyl-CoA dehydrogenase FadE25 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=fadE25 PE=1 SV=1
10	P15651	1.22e-90	281	412	0.371	0.379	ACADS_RAT Short-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Acads PE=1 SV=2
11	Q07417	6.32e-89	277	412	0.366	0.374	ACADS_MOUSE Short-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Acads PE=1 SV=2
12	Q2LQP0	2.29e-88	275	384	0.361	0.396	CHCOA_SYNAS Cyclohexane-1-carbonyl-CoA dehydrogenase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=SYN_02586 PE=1 SV=1
13	Q2LQN9	5.55e-87	272	414	0.361	0.367	CH1CO_SYNAS Cyclohex-1-ene-1-carbonyl-CoA dehydrogenase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=SYN_02587 PE=1 SV=1
14	E5KSD5	2.31e-86	271	412	0.366	0.374	E5KSD5_HUMAN Acyl-Coenzyme A dehydrogenase, C-2 to C-3 short chain OS=Homo sapiens OX=9606 GN=ACADS PE=3 SV=1
15	P16219	2.31e-86	271	412	0.366	0.374	ACADS_HUMAN Short-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=ACADS PE=1 SV=1
16	Q3ZBF6	8.07e-84	264	412	0.373	0.381	ACADS_BOVIN Short-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Bos taurus OX=9913 GN=ACADS PE=1 SV=1
17	H6LGM6	3.76e-79	251	379	0.340	0.377	CARC_ACEWD Caffeyl-CoA reductase-Etf complex subunit CarC OS=Acetobacterium woodii (strain ATCC 29683 / DSM 1030 / JCM 2381 / KCTC 1655 / WB1) OX=931626 GN=carC PE=1 SV=1
18	G3KIM8	3.36e-77	246	394	0.333	0.355	ACRC_ANAPI Acryloyl-CoA reductase (NADH) OS=Anaerotignum propionicum OX=28446 GN=acrC PE=1 SV=1
19	A0A0S2Z3P9	5.53e-77	247	432	0.335	0.326	A0A0S2Z3P9_HUMAN Acyl-CoA dehydrogenase short/branched chain isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=ACADSB PE=2 SV=1
20	P45954	5.53e-77	247	432	0.335	0.326	ACDSB_HUMAN Short/branched chain specific acyl-CoA dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=ACADSB PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00441 Acyl-CoA_dh_1	1.6e-45	166.5	Acyl-CoA dehydrogenase, C-terminal domain
2	PF08028 Acyl-CoA_dh_2	7.6e-18	76.5	Acyl-CoA dehydrogenase, C-terminal domain
3	PF02770 Acyl-CoA_dh_M	4.9e-23	92.5	Acyl-CoA dehydrogenase, middle domain
4	PF02771 Acyl-CoA_dh_N	2.5e-25	100.7	Acyl-CoA dehydrogenase, N-terminal domain
5	PF11794 HpaB_N	0.15	23.2	4-hydroxyphenylacetate 3-hydroxylase N terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000052172

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000017023	0.998	Acetyl-CoA acyltransferase 2
2	9598.ENSPTRP00000020160	0.998	Trifunctional enzyme subunit beta, mitochondrial
3	9598.ENSPTRP00000020159	0.997	Hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (Trifunctional protein), alpha subunit
4	9598.ENSPTRP00000017616	0.987	Bubblegum related protein
5	9598.ENSPTRP00000025446	0.985	Acetyl-CoA acyltransferase 1
6	9598.ENSPTRP00000001722	0.981	Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial
7	9598.ENSPTRP00000027013	0.978	Enoyl-CoA, hydratase/3-hydroxyacyl CoA dehydrogenase
8	9598.ENSPTRP00000001287	0.976	Carnitine palmitoyltransferase 2
9	9598.ENSPTRP00000012543	0.975	acyl-CoA synthetase bubblegum family member 1
10	9598.ENSPTRP00000012506	0.970	Electron-transfer-flavoprotein, alpha polypeptide
11	9598.ENSPTRP00000014443	0.962	acyl-CoA synthetase family member 3
12	9598.ENSPTRP00000041973	0.948	acyl-CoA synthetase long-chain family member 6
13	9598.ENSPTRP00000043677	0.948	Acyl-CoA synthetase long-chain family member 5
14	9598.ENSPTRP00000007309	0.945	Acetyl-CoA acetyltransferase 1
15	9598.ENSPTRP00000026948	0.945	Methylcrotonoyl-CoA carboxylase 1 (Alpha)
16	9598.ENSPTRP00000022015	0.941	acyl-CoA dehydrogenase, long chain
17	9598.ENSPTRP00000055489	0.939	Uncharacterized protein
18	9598.ENSPTRP00000022173	0.933	Acyl-CoA synthetase long-chain family member 3
19	9598.ENSPTRP00000016422	0.931	Acyl-coenzyme A oxidase
20	9598.ENSPTRP00000038175	0.929	Acyl-CoA synthetase long-chain family member 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005488	0.997	binding
GO:0003995	0.997	acyl-CoA dehydrogenase activity
GO:0005515	0.987	protein binding
GO:0042802	0.900	identical protein binding
GO:0050660	0.854	flavin adenine dinucleotide binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.998	organic substance metabolic process
GO:0044238	0.998	primary metabolic process
GO:0044237	0.997	cellular metabolic process
GO:0032787	0.990	monocarboxylic acid metabolic process
GO:0006629	0.983	lipid metabolic process
GO:0044282	0.981	small molecule catabolic process
GO:0006635	0.966	fatty acid beta-oxidation
GO:0006807	0.651	nitrogen compound metabolic process
GO:1901564	0.594	organonitrogen compound metabolic process
GO:0009058	0.309	biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0070013	0.978	intracellular organelle lumen
GO:0016020	0.384	membrane
GO:0031090	0.324	organelle membrane
GO:0005759	0.321	mitochondrial matrix

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.3.-.-	0.997	Acting on the CH-CH group of donors.

[back to server]