StarFunc result for job id P11362

User Input

>input (822 residues)
MWSWKCLLFWAVLVTATLCTARPSPTLPEQAQPWGAPVEVESFLVHPGDLLQLRCRLRDD
VQSINWLRDGVQLAESNRTRITGEEVEVQDSVPADSGLYACVTSSPSGSDTTYFSVNVSD
ALPSSEDDDDDDDSSSEEKETDNTKPNRMPVAPYWTSPEKMEKKLHAVPAAKTVKFKCPS
SGTPNPTLRWLKNGKEFKPDHRIGGYKVRYATWSIIMDSVVPSDKGNYTCIVENEYGSIN
HTYQLDVVERSPHRPILQAGLPANKTVALGSNVEFMCKVYSDPQPHIQWLKHIEVNGSKI
GPDNLPYVQILKTAGVNTTDKEMEVLHLRNVSFEDAGEYTCLAGNSIGLSHHSAWLTVLE
ALEERPAVMTSPLYLEIIIYCTGAFLISCMVGSVIVYKMKSGTKKSDFHSQMAVHKLAKS
IPLRRQVTVSADSSASMNSGVLLVRPSRLSSSGTPMLAGVSEYELPEDPRWELPRDRLVL
GKPLGEGCFGQVVLAEAIGLDKDKPNRVTKVAVKMLKSDATEKDLSDLISEMEMMKMIGK
HKNIINLLGACTQDGPLYVIVEYASKGNLREYLQARRPPGLEYCYNPSHNPEEQLSSKDL
VSCAYQVARGMEYLASKKCIHRDLAARNVLVTEDNVMKIADFGLARDIHHIDYYKKTTNG
RLPVKWMAPEALFDRIYTHQSDVWSFGVLLWEIFTLGGSPYPGVPVEELFKLLKEGHRMD
KPSNCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRIVALTSNQEYLDLSMPLDQYSPSF
PDTRSSTCSSGEDSVFSHEPLPEEPCLPRHPAQLANGGLKRR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0G2K210	0.393	0.403	0.000	802	0.588	0.602	A0A0G2K210.pdb.gz	A0A0G2K210_RAT Fibroblast growth factor receptor OS=Rattus norvegicus OX=10116 GN=Fgfr3 PE=1 SV=2
2	AFDB:A4JYQ2	0.424	0.433	0.000	802	0.628	0.643	A4JYQ2.pdb.gz
3	AFDB:F1LSG7	0.600	0.588	0.000	841	0.695	0.679	F1LSG7.pdb.gz	F1LSG7_RAT Fibroblast growth factor receptor OS=Rattus norvegicus OX=10116 GN=Fgfr2 PE=3 SV=1
4	AFDB:G1K2P2	0.401	0.442	0.000	740	0.646	0.718	G1K2P2.pdb.gz
5	AFDB:G1K2P7	0.388	0.415	0.000	766	0.672	0.721	G1K2P7.pdb.gz
6	AFDB:P11362	1.000	1.000	0.000	822	1.000	1.000	P11362.pdb.gz	FGFR1_HUMAN Fibroblast growth factor receptor 1 OS=Homo sapiens OX=9606 GN=FGFR1 PE=1 SV=3
7	AFDB:P22607	0.578	0.588	0.000	806	0.618	0.630	P22607.pdb.gz	FGFR3_HUMAN Fibroblast growth factor receptor 3 OS=Homo sapiens OX=9606 GN=FGFR3 PE=1 SV=1
8	AFDB:Q498D6	0.373	0.383	0.000	800	0.566	0.581	Q498D6.pdb.gz	FGFR4_RAT Fibroblast growth factor receptor 4 OS=Rattus norvegicus OX=10116 GN=Fgfr4 PE=1 SV=1
9	AFDB:Q8JG38	0.388	0.391	0.000	817	0.661	0.665	Q8JG38.pdb.gz	FGFR2_DANRE Fibroblast growth factor receptor 2 OS=Danio rerio OX=7955 GN=fgfr2 PE=1 SV=1
10	AFDB:Q90413	0.559	0.504	0.000	922	0.592	0.528	Q90413.pdb.gz	FGFR4_DANRE Fibroblast growth factor receptor 4 OS=Danio rerio OX=7955 GN=fgfr4 PE=1 SV=1
11	PDB:1k9aB	0.298	0.548	3.311E-26	441	0.136	0.254	1k9aB.pdb.gz
12	PDB:2h8hA	0.283	0.504	3.248E-24	445	0.134	0.247	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
13	PDB:4fl2A	0.291	0.424	1.496E-21	555	0.123	0.182	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
14	PDB:4k2rA	0.292	0.429	1.113E-19	551	0.108	0.162	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
15	PDB:2qkwB	0.277	0.726	1.699E-17	292	0.079	0.223	2qkwB.pdb.gz
16	PDB:6dldD	0.106	0.290	3.298E-17	269	0.074	0.227	6dldD.pdb.gz
17	PDB:1unlA	0.280	0.752	1.175E-16	292	0.073	0.205	1unlA.pdb.gz	Mechanism of Cdk5/P25 Binding by Cdk Inhibitors
18	PDB:8dksA	0.254	0.683	1.242E-16	283	0.095	0.276	8dksA.pdb.gz	Bicyclic pyrimidine compounds as potent IRAK4 inhibitors.
19	PDB:5u6yA	0.279	0.482	1.387E-16	459	0.085	0.153	5u6yA.pdb.gz
20	PDB:4zhxA	0.282	0.545	1.730E-16	409	0.084	0.169	4zhxA.pdb.gz	Structural basis of allosteric and synergistic activation of AMPK by furan-2-phosphonic derivative C2 binding.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0G2K210	952	803	0.594	0.608	A0A0G2K210_RAT Fibroblast growth factor receptor OS=Rattus norvegicus OX=10116 GN=Fgfr3 PE=1 SV=2
2	A0A8I5Y7R6	993	782	0.611	0.642	A0A8I5Y7R6_RAT Fibroblast growth factor receptor OS=Rattus norvegicus OX=10116 GN=Fgfr3 PE=3 SV=1
3	F1LN06	1061	726	0.627	0.709	F1LN06_RAT Fibroblast growth factor receptor OS=Rattus norvegicus OX=10116 GN=Fgfr2 PE=3 SV=1
4	F1LNW0	1185	840	0.718	0.702	F1LNW0_RAT Fibroblast growth factor receptor OS=Rattus norvegicus OX=10116 GN=Fgfr2 PE=3 SV=1
5	F1LRU8	1063	752	0.627	0.685	F1LRU8_RAT Fibroblast growth factor receptor OS=Rattus norvegicus OX=10116 GN=Fgfr2 PE=3 SV=1
6	F1LSG7	1140	841	0.698	0.683	F1LSG7_RAT Fibroblast growth factor receptor OS=Rattus norvegicus OX=10116 GN=Fgfr2 PE=3 SV=1
7	F1LSN4	1014	801	0.622	0.638	F1LSN4_RAT Fibroblast growth factor receptor OS=Rattus norvegicus OX=10116 GN=Fgfr3 PE=1 SV=3
8	F8W9L4	759	792	0.471	0.489	F8W9L4_HUMAN Fibroblast growth factor receptor OS=Homo sapiens OX=9606 GN=FGFR3 PE=1 SV=1
9	P11362	1709	822	1.000	1.000	FGFR1_HUMAN Fibroblast growth factor receptor 1 OS=Homo sapiens OX=9606 GN=FGFR1 PE=1 SV=3
10	P16092	1687	822	0.984	0.984	FGFR1_MOUSE Fibroblast growth factor receptor 1 OS=Mus musculus OX=10090 GN=Fgfr1 PE=1 SV=2
11	P21802	1208	821	0.723	0.724	FGFR2_HUMAN Fibroblast growth factor receptor 2 OS=Homo sapiens OX=9606 GN=FGFR2 PE=1 SV=1
12	P21803	1153	821	0.713	0.714	FGFR2_MOUSE Fibroblast growth factor receptor 2 OS=Mus musculus OX=10090 GN=Fgfr2 PE=1 SV=4
13	P21804	1518	819	0.915	0.918	FGFR1_CHICK Fibroblast growth factor receptor 1 OS=Gallus gallus OX=9031 GN=FGFR1 PE=2 SV=1
14	P22455	871	802	0.544	0.557	FGFR4_HUMAN Fibroblast growth factor receptor 4 OS=Homo sapiens OX=9606 GN=FGFR4 PE=1 SV=2
15	P22607	999	806	0.612	0.624	FGFR3_HUMAN Fibroblast growth factor receptor 3 OS=Homo sapiens OX=9606 GN=FGFR3 PE=1 SV=1
16	Q03142	869	799	0.551	0.567	FGFR4_MOUSE Fibroblast growth factor receptor 4 OS=Mus musculus OX=10090 GN=Fgfr4 PE=1 SV=3
17	Q04589	1672	822	0.977	0.977	FGFR1_RAT Fibroblast growth factor receptor 1 OS=Rattus norvegicus OX=10116 GN=Fgfr1 PE=1 SV=1
18	Q498D6	881	800	0.549	0.564	FGFR4_RAT Fibroblast growth factor receptor 4 OS=Rattus norvegicus OX=10116 GN=Fgfr4 PE=1 SV=1
19	Q61851	999	801	0.618	0.634	FGFR3_MOUSE Fibroblast growth factor receptor 3 OS=Mus musculus OX=10090 GN=Fgfr3 PE=1 SV=1
20	Q63240	557	374	0.332	0.730	Q63240_RAT Heparin-binding fibroblast growth factor receptor 2 (Fragment) OS=Rattus norvegicus OX=10116 GN=Fgfr2 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	7.8	17.1	ABC1 atypical kinase-like domain
2	PF08205 C2-set_2	0.38	22.2	CD80-like C2-set immunoglobulin domain
3	PF07759 DUF1615	6.9e+02	10.8	Protein of unknown function (DUF1615)
4	PF07679 I-set	1e-34	129.8	Immunoglobulin I-set domain
5	PF00047 ig	1e-25	101.0	Immunoglobulin domain
6	PF13895 Ig_2	4.4e-21	86.3	Immunoglobulin domain
7	PF13927 Ig_3	2e-28	110.1	Immunoglobulin domain
8	PF16680 Ig_4	1.5	20.8	T-cell surface glycoprotein CD3 delta chain
9	PF16681 Ig_5	0.00031	32.5	Ig-like domain on T-cell surface glycoprotein CD3 epsilon chain
10	PF00069 Pkinase	1.8e-42	157.1	Protein kinase domain
11	PF17667 Pkinase_fungal	68	13.7	Fungal protein kinase
12	PF07714 PK_Tyr_Ser-Thr	4.7e-101	349.0	Protein tyrosine and serine/threonine kinase
13	PF07686 V-set	1.4e-10	52.7	Immunoglobulin V-set domain
14	PF08204 V-set_CD47	3.6e+02	12.5	CD47 immunoglobulin-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_008954378.1

Rank	PPI partner	STRING score	Description
1	9597.XP_003808771.1	0.998	Fibroblast growth factor receptor substrate 2
2	9597.XP_003820387.1	0.998	Belongs to the heparin-binding growth factors family.
3	9597.XP_003825944.1	0.998	Phospholipase C gamma 1
4	9597.XP_008967714.1	0.998	Belongs to the heparin-binding growth factors family.
5	9597.XP_003826967.1	0.996	Klotho
6	9597.XP_003832230.1	0.996	Klotho beta
7	9597.XP_003829149.2	0.994	Plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell migration. Functions as potent mitogen in vitro. Acts as a ligand for FGFR1 and integrins. Binds to FGFR1 in the presence of heparin leading to FGFR1 dimerization and activation via sequential autophosphorylation on tyrosine residues which act as docking sites for interacting proteins, leading to the activation of several signaling cascades. Binds to integrins. Its binding to integrins and subsequent ternary complex formation with integrins and FGFR1 are essential for [...]
8	9597.XP_003813338.1	0.989	Growth factor receptor bound protein 2
9	9597.XP_003833080.1	0.985	Belongs to the heparin-binding growth factors family.
10	9597.XP_003806041.1	0.975	HRas proto-oncogene, GTPase
11	9597.XP_008949274.1	0.975	Belongs to the heparin-binding growth factors family.
12	9597.XP_003806841.1	0.971	Phosphoinositide-3-kinase regulatory subunit 1
13	9597.XP_008952491.1	0.971	Fibroblast growth factor 4
14	9597.XP_003820386.1	0.967	Belongs to the heparin-binding growth factors family.
15	9597.XP_003814163.2	0.965	Fibroblast growth factor 21
16	9597.XP_003811059.1	0.964	Belongs to the heparin-binding growth factors family.
17	9597.XP_008955633.1	0.963	Phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha
18	9597.XP_008971793.1	0.962	Neuroblastoma RAS viral oncogene homolog
19	9597.XP_008957702.1	0.954	Anosmin 1
20	9597.XP_003831549.1	0.951	Belongs to the heparin-binding growth factors family.

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005007	0.997	fibroblast growth factor receptor activity
GO:0042802	0.988	identical protein binding
GO:0019838	0.987	growth factor binding
GO:0017134	0.949	fibroblast growth factor binding
GO:0046983	0.834	protein dimerization activity
GO:0042803	0.746	protein homodimerization activity
GO:0005102	0.603	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0048518	0.998	positive regulation of biological process
GO:0048522	0.990	positive regulation of cellular process
GO:0009987	0.963	cellular process
GO:0048856	0.933	anatomical structure development
GO:0070848	0.930	response to growth factor
GO:0007169	0.926	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0071363	0.922	cellular response to growth factor stimulus
GO:0080090	0.896	regulation of primary metabolic process
GO:0071774	0.896	response to fibroblast growth factor
GO:0051171	0.894	regulation of nitrogen compound metabolic process
GO:0060255	0.893	regulation of macromolecule metabolic process
GO:0009966	0.891	regulation of signal transduction
GO:0031323	0.890	regulation of cellular metabolic process
GO:0048584	0.888	positive regulation of response to stimulus
GO:0008543	0.882	fibroblast growth factor receptor signaling pathway
GO:0009967	0.879	positive regulation of signal transduction
GO:0010468	0.873	regulation of gene expression
GO:0008284	0.869	positive regulation of cell population proliferation
GO:0009889	0.862	regulation of biosynthetic process
GO:0019219	0.859	regulation of nucleobase-containing compound metabolic process
GO:0048513	0.821	animal organ development
GO:0044093	0.816	positive regulation of molecular function
GO:0051252	0.788	regulation of RNA metabolic process
GO:0010556	0.787	regulation of macromolecule biosynthetic process
GO:0031326	0.781	regulation of cellular biosynthetic process
GO:0009653	0.778	anatomical structure morphogenesis
GO:1903506	0.765	regulation of nucleic acid-templated transcription
GO:0006355	0.762	regulation of DNA-templated transcription
GO:0032501	0.751	multicellular organismal process
GO:0007275	0.738	multicellular organism development
GO:0048731	0.673	system development
GO:0050793	0.647	regulation of developmental process
GO:0032101	0.638	regulation of response to external stimulus
GO:0048869	0.561	cellular developmental process
GO:0030154	0.535	cell differentiation
GO:0080134	0.502	regulation of response to stress
GO:0071704	0.480	organic substance metabolic process
GO:0032103	0.480	positive regulation of response to external stimulus
GO:0044237	0.478	cellular metabolic process
GO:0044238	0.468	primary metabolic process
GO:0042221	0.393	response to chemical
GO:0048519	0.387	negative regulation of biological process
GO:0006807	0.366	nitrogen compound metabolic process
GO:0006796	0.359	phosphate-containing compound metabolic process
GO:0036211	0.356	protein modification process
GO:0002682	0.318	regulation of immune system process
GO:0002684	0.313	positive regulation of immune system process
GO:0010033	0.303	response to organic substance

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005622	1.000	intracellular anatomical structure
GO:0005886	1.000	plasma membrane
GO:0005737	0.993	cytoplasm
GO:0043229	0.977	intracellular organelle
GO:0043227	0.974	membrane-bounded organelle
GO:0043231	0.964	intracellular membrane-bounded organelle
GO:0005634	0.882	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.10.1	1.000	receptor protein-tyrosine kinase.

[back to server]