StarFunc result for job id P11388

User Input

>input (1531 residues)
MEVSPLQPVNENMQVNKIKKNEDAKKRLSVERIYQKKTQLEHILLRPDTYIGSVELVTQQ
MWVYDEDVGINYREVTFVPGLYKIFDEILVNAADNKQRDPKMSCIRVTIDPENNLISIWN
NGKGIPVVEHKVEKMYVPALIFGQLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTKFTVE
TASREYKKMFKQTWMDNMGRAGEMELKPFNGEDYTCITFQPDLSKFKMQSLDKDIVALMV
RRAYDIAGSTKDVKVFLNGNKLPVKGFRSYVDMYLKDKLDETGNSLKVIHEQVNHRWEVC
LTMSEKGFQQISFVNSIATSKGGRHVDYVADQIVTKLVDVVKKKNKGGVAVKAHQVKNHM
WIFVNALIENPTFDSQTKENMTLQPKSFGSTCQLSEKFIKAAIGCGIVESILNWVKFKAQ
VQLNKKCSAVKHNRIKGIPKLDDANDAGGRNSTECTLILTEGDSAKTLAVSGLGVVGRDK
YGVFPLRGKILNVREASHKQIMENAEINNIIKIVGLQYKKNYEDEDSLKTLRYGKIMIMT
DQDQDGSHIKGLLINFIHHNWPSLLRHRFLEEFITPIVKVSKNKQEMAFYSLPEFEEWKS
STPNHKKWKVKYYKGLGTSTSKEAKEYFADMKRHRIQFKYSGPEDDAAISLAFSKKQIDD
RKEWLTNFMEDRRQRKLLGLPEDYLYGQTTTYLTYNDFINKELILFSNSDNERSIPSMVD
GLKPGQRKVLFTCFKRNDKREVKVAQLAGSVAEMSSYHHGEMSLMMTIINLAQNFVGSNN
LNLLQPIGQFGTRLHGGKDSASPRYIFTMLSSLARLLFPPKDDHTLKFLYDDNQRVEPEW
YIPIIPMVLINGAEGIGTGWSCKIPNFDVREIVNNIRRLMDGEEPLPMLPSYKNFKGTIE
ELAPNQYVISGEVAILNSTTIEISELPVRTWTQTYKEQVLEPMLNGTEKTPPLITDYREY
HTDTTVKFVVKMTEEKLAEAERVGLHKVFKLQTSLTCNSMVLFDHVGCLKKYDTVLDILR
DFFELRLKYYGLRKEWLLGMLGAESAKLNNQARFILEKIDGKIIIENKPKKELIKVLIQR
GYDSDPVKAWKEAQQKVPDEEENEESDNEKETEKSDSVTDSGPTFNYLLDMPLWYLTKEK
KDELCRLRNEKEQELDTLKRKSPSDLWKEDLATFIEELEAVEAKEKQDEQVGLPGKGGKA
KGKKTQMAEVLPSPRGQRVIPRITIEMKAEAEKKNKKKIKNENTEGSPQEDGVELEGLKQ
RLEKKQKREPGTKTKKQTTLAFKPIKKGKKRNPWSDSESDRSSDESNFDVPPRETEPRRA
ATKTKFTMDLDSDEDFSDFDEKTDDEDFVPSDASPPKTKTSPKLSNKELKPQKSVVSDLE
ADDVKGSVPLSSSPPATHFPDETEITNPVPKKNVTVKKTAAKSQSSTSTTGAKKRAAPKG
TKRDPALNSGVSQKPDPAKTKNRRKRKPSTSDDSDSNFEKIVSKAVTSKKSKGESDDFHM
DFDSAVAPRAKSVRAKKPIKYLEESDEDDLF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:6zy7B	0.505	0.657	0.000	1160	0.757	0.999	6zy7B.pdb.gz	Structural basis for allosteric regulation of Human Topoisomerase II alpha.
2	AFDB:A0A0R4IUF0	0.784	0.765	0.000	1570	0.685	0.668	A0A0R4IUF0.pdb.gz	A0A0R4IUF0_DANRE DNA topoisomerase 2 OS=Danio rerio OX=7955 GN=fc08c07 PE=1 SV=2
3	AFDB:O42130	0.750	0.740	0.000	1553	0.768	0.757	O42130.pdb.gz	TOP2A_CHICK DNA topoisomerase 2-alpha OS=Gallus gallus OX=9031 GN=TOP2A PE=2 SV=2
4	AFDB:O42131	0.797	0.751	0.000	1627	0.702	0.660	O42131.pdb.gz	TOP2B_CHICK DNA topoisomerase 2-beta OS=Gallus gallus OX=9031 GN=TOP2B PE=2 SV=1
5	AFDB:P11388	1.000	1.000	0.000	1531	1.000	1.000	P11388.pdb.gz	TOP2A_HUMAN DNA topoisomerase 2-alpha OS=Homo sapiens OX=9606 GN=TOP2A PE=1 SV=3
6	AFDB:P15348	0.758	0.801	0.000	1447	0.520	0.550	P15348.pdb.gz	TOP2_DROME DNA topoisomerase 2 OS=Drosophila melanogaster OX=7227 GN=Top2 PE=1 SV=1
7	AFDB:Q01320	0.801	0.803	0.000	1528	0.890	0.892	Q01320.pdb.gz	TOP2A_MOUSE DNA topoisomerase 2-alpha OS=Mus musculus OX=10090 GN=Top2a PE=1 SV=2
8	AFDB:Q1LUT2	0.791	0.749	0.000	1618	0.662	0.627	Q1LUT2.pdb.gz	Q1LUT2_DANRE DNA topoisomerase 2 OS=Danio rerio OX=7955 GN=im:7138121 PE=1 SV=1
9	PDB:6rkwD	0.212	0.399	1.246E-30	781	0.090	0.177	6rkwD.pdb.gz	Cryo-EM structure of the complete E. coli DNA gyrase nucleoprotein complex.
10	PDB:6rkwC	0.253	0.451	5.330E-18	828	0.069	0.127	6rkwC.pdb.gz	Cryo-EM structure of the complete E. coli DNA gyrase nucleoprotein complex.
11	PDB:1zvuA	0.238	0.498	2.507E-16	685	0.056	0.126	1zvuA.pdb.gz
12	PDB:7p8vA	0.142	0.540	2.822E-10	331	0.026	0.121	7p8vA.pdb.gz	MutL binds to 3' resected DNA ends and blocks DNA polymerase access.
13	PDB:5tthB	0.162	0.344	6.208E-9	621	0.058	0.143	5tthB.pdb.gz	Symmetry broken and rebroken during the ATP hydrolysis cycle of the mitochondrial Hsp90 TRAP1.
14	PDB:2cg9B	0.138	0.303	7.603E-9	618	0.041	0.102	2cg9B.pdb.gz	Crystal Structure of an Hsp90-Nucleotide-P23/Sba1 Closed Chaperone Complex
15	PDB:5tthA	0.146	0.302	7.998E-9	671	0.042	0.097	5tthA.pdb.gz	Symmetry broken and rebroken during the ATP hydrolysis cycle of the mitochondrial Hsp90 TRAP1.
16	PDB:6rksD	0.101	0.705	8.414E-9	200	0.039	0.295	6rksD.pdb.gz	Cryo-EM structure of the complete E. coli DNA gyrase nucleoprotein complex.
17	PDB:1y4uB	0.102	0.252	1.469E-8	454	0.040	0.134	1y4uB.pdb.gz
18	AFDB:Q9H254	0.031	0.021	3.880E-1	2564	0.050	0.030	Q9H254.pdb.gz	SPTN4_HUMAN Spectrin beta chain, non-erythrocytic 4 OS=Homo sapiens OX=9606 GN=SPTBN4 PE=1 SV=2
19	AFDB:A0A0R4IEP9	0.029	0.032	1.016	1332	0.050	0.057	A0A0R4IEP9.pdb.gz	A0A0R4IEP9_DANRE TRAF2 and NCK interacting kinase a isoform X4 OS=Danio rerio OX=7955 GN=fc52d11 PE=1 SV=1
20	AFDB:A2AUM9	0.032	0.028	1.069	1736	0.053	0.047	A2AUM9.pdb.gz	CE152_MOUSE Centrosomal protein of 152 kDa OS=Mus musculus OX=10090 GN=Cep152 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0R4IUF0	2069	1570	0.681	0.664	A0A0R4IUF0_DANRE DNA topoisomerase 2 OS=Danio rerio OX=7955 GN=fc08c07 PE=1 SV=2
2	A0A1D8PMM1	1109	1461	0.385	0.404	A0A1D8PMM1_CANAL DNA topoisomerase 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=TOP2 PE=3 SV=1
3	A0A8I5Y7L4	2100	1614	0.702	0.665	A0A8I5Y7L4_RAT DNA topoisomerase 2 OS=Rattus norvegicus OX=10116 GN=Top2b PE=1 SV=1
4	O42130	2309	1553	0.766	0.755	TOP2A_CHICK DNA topoisomerase 2-alpha OS=Gallus gallus OX=9031 GN=TOP2A PE=2 SV=2
5	O42131	2128	1627	0.710	0.668	TOP2B_CHICK DNA topoisomerase 2-beta OS=Gallus gallus OX=9031 GN=TOP2B PE=2 SV=1
6	P06786	1053	1428	0.373	0.400	TOP2_YEAST DNA topoisomerase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TOP2 PE=1 SV=2
7	P08096	1168	1485	0.386	0.398	TOP2_SCHPO DNA topoisomerase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=top2 PE=1 SV=2
8	P11388	3165	1531	1.000	1.000	TOP2A_HUMAN DNA topoisomerase 2-alpha OS=Homo sapiens OX=9606 GN=TOP2A PE=1 SV=3
9	P12531	579	1221	0.261	0.328	TOP2_TRYBB DNA topoisomerase 2 OS=Trypanosoma brucei brucei OX=5702 GN=TOP2 PE=3 SV=1
10	P15348	1549	1447	0.491	0.519	TOP2_DROME DNA topoisomerase 2 OS=Drosophila melanogaster OX=7227 GN=Top2 PE=1 SV=1
11	P30182	1153	1473	0.404	0.420	TOP2_ARATH DNA topoisomerase 2 OS=Arabidopsis thaliana OX=3702 GN=TOP2 PE=2 SV=2
12	P41516	2742	1526	0.886	0.889	TOP2A_RAT DNA topoisomerase 2-alpha OS=Rattus norvegicus OX=10116 GN=Top2a PE=1 SV=1
13	P90520	918	1284	0.338	0.403	TOP2M_DICDI DNA topoisomerase 2, mitochondrial OS=Dictyostelium discoideum OX=44689 GN=top2mt PE=2 SV=2
14	Q01320	2761	1528	0.893	0.895	TOP2A_MOUSE DNA topoisomerase 2-alpha OS=Mus musculus OX=10090 GN=Top2a PE=1 SV=2
15	Q02880	2113	1626	0.707	0.665	TOP2B_HUMAN DNA topoisomerase 2-beta OS=Homo sapiens OX=9606 GN=TOP2B PE=1 SV=3
16	Q14TE9	2097	1614	0.700	0.664	Q14TE9_RAT DNA topoisomerase 2 OS=Rattus norvegicus OX=10116 GN=Top2b PE=2 SV=1
17	Q1LUT2	1995	1618	0.630	0.596	Q1LUT2_DANRE DNA topoisomerase 2 OS=Danio rerio OX=7955 GN=im:7138121 PE=1 SV=1
18	Q23670	1540	1520	0.489	0.493	TOP2_CAEEL DNA topoisomerase 2 top-2 OS=Caenorhabditis elegans OX=6239 GN=top-2 PE=1 SV=2
19	Q383C4	1004	1424	0.351	0.378	Q383C4_TRYB2 DNA topoisomerase 2 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.3390 PE=3 SV=1
20	Q5B224	1073	1709	0.370	0.331	Q5B224_EMENI DNA topoisomerase 2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_05406 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00204 DNA_gyraseB	8.3e-25	98.8	DNA gyrase B
2	PF00521 DNA_topoisoIV	7.5e-129	442.0	DNA gyrase/topoisomerase IV, subunit A
3	PF08070 DTHCT	1e-17	76.1	DTHCT (NUC029) region
4	PF03516 Filaggrin	1.8e+02	14.2	Filaggrin
5	PF02518 HATPase_c	4.2e-13	61.2	Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
6	PF01751 Toprim	3.9e-06	38.4	Toprim domain
7	PF16898 TOPRIM_C	3.2e-47	171.3	C-terminal associated domain of TOPRIM

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000411532

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000300403	0.997	Targeting protein for Xklp2
2	9606.ENSP00000378699	0.996	Cyclin-dependent kinase 1
3	9606.ENSP00000348838	0.993	Ubiquitin-conjugating enzyme E2 C
4	9606.ENSP00000354522	0.993	DNA topoisomerase 1
5	9606.ENSP00000428489	0.992	Lymphokine-activated killer T-cell-originated protein kinase
6	9606.ENSP00000288207	0.991	G2/mitotic-specific cyclin-B2
7	9606.ENSP00000302530	0.991	Mitotic checkpoint serine/threonine-protein kinase BUB1
8	9606.ENSP00000363524	0.991	Chromosome-associated kinesin KIF4A
9	9606.ENSP00000247191	0.990	Disks large-associated protein 5
10	9606.ENSP00000251496	0.990	Condensin complex subunit 3
11	9606.ENSP00000378356	0.990	Kinesin-like protein KIF20A
12	9606.ENSP00000256442	0.988	G2/mitotic-specific cyclin-B1
13	9606.ENSP00000357643	0.988	Proliferation marker protein Ki-67
14	9606.ENSP00000260731	0.987	Kinesin-like protein KIF11
15	9606.ENSP00000356379	0.987	Abnormal spindle-like microcephaly-associated protein
16	9606.ENSP00000361540	0.987	Cell division cycle protein 20 homolog
17	9606.ENSP00000453403	0.987	Nucleolar and spindle-associated protein 1
18	9606.ENSP00000287598	0.986	Mitotic checkpoint serine/threonine-protein kinase BUB1 beta
19	9606.ENSP00000355922	0.986	Centromere protein F
20	9606.ENSP00000274026	0.985	Cyclin-A2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0003918	0.998	DNA topoisomerase type II (double strand cut, ATP-hydrolyzing) activity
GO:1901363	0.978	heterocyclic compound binding
GO:0097159	0.978	organic cyclic compound binding
GO:0003676	0.958	nucleic acid binding
GO:0003682	0.939	chromatin binding
GO:0003677	0.923	DNA binding
GO:0043167	0.677	ion binding
GO:0003723	0.619	RNA binding
GO:0019899	0.561	enzyme binding
GO:0019900	0.301	kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0008152	0.932	metabolic process
GO:0071704	0.914	organic substance metabolic process
GO:0044237	0.906	cellular metabolic process
GO:0043170	0.891	macromolecule metabolic process
GO:0044238	0.883	primary metabolic process
GO:0034641	0.883	cellular nitrogen compound metabolic process
GO:0090304	0.874	nucleic acid metabolic process
GO:0071840	0.868	cellular component organization or biogenesis
GO:0044260	0.858	cellular macromolecule metabolic process
GO:0016043	0.805	cellular component organization
GO:0050789	0.780	regulation of biological process
GO:0050794	0.733	regulation of cellular process
GO:0006259	0.688	DNA metabolic process
GO:0007049	0.651	cell cycle
GO:0022402	0.626	cell cycle process
GO:0006996	0.586	organelle organization
GO:0019222	0.496	regulation of metabolic process
GO:0060255	0.392	regulation of macromolecule metabolic process
GO:0048518	0.352	positive regulation of biological process
GO:0080090	0.345	regulation of primary metabolic process
GO:0051171	0.345	regulation of nitrogen compound metabolic process
GO:0031323	0.345	regulation of cellular metabolic process
GO:0048522	0.340	positive regulation of cellular process
GO:0050896	0.303	response to stimulus
GO:0019219	0.301	regulation of nucleobase-containing compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043232	0.999	intracellular non-membrane-bounded organelle
GO:0031981	0.998	nuclear lumen
GO:0005654	0.976	nucleoplasm
GO:0032991	0.868	protein-containing complex
GO:0005694	0.740	chromosome
GO:0005730	0.710	nucleolus
GO:0005829	0.680	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:5.6.2.2	0.998	DNA topoisomerase (ATP-hydrolyzing).

[back to server]