StarFunc result for job id P11441

User Input

>input (157 residues)
MQLTVKALQGRECSLQVPEDELVSTLKQLVSEKLNVPVRQQRLLFKGKALADGKRLSDYS
IGPNSKLNLVVKPLEKVLLEEGEAQRLADSPPPQVWQLISKVLARHFSAADASRVLEQLQ
RDYERSLSRLTLDDIERLASRFLHPEVTETMEKGFSK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B2GV38	0.488	0.488	1.011E-25	157	0.885	0.885	B2GV38.pdb.gz	UBL4A_RAT Ubiquitin-like protein 4A OS=Rattus norvegicus OX=10116 GN=Ubl4a PE=2 SV=1
2	AFDB:B7NZQ9	0.484	0.484	2.042E-25	157	0.936	0.936	B7NZQ9.pdb.gz	UBL4A_RABIT Ubiquitin-like protein 4A OS=Oryctolagus cuniculus OX=9986 GN=UBL4A PE=3 SV=1
3	AFDB:Q5HY81	0.480	0.421	1.008E-23	180	0.879	0.767	Q5HY81.pdb.gz	Q5HY81_HUMAN Ubiquitin-like protein 4A OS=Homo sapiens OX=9606 GN=UBL4A PE=1 SV=2
4	AFDB:Q8N7F7	0.470	0.424	1.206E-16	174	0.420	0.379	Q8N7F7.pdb.gz	UBL4B_HUMAN Ubiquitin-like protein 4B OS=Homo sapiens OX=9606 GN=UBL4B PE=1 SV=1
5	AFDB:P0C016	0.460	0.481	1.194E-10	150	0.204	0.213	P0C016.pdb.gz	RS27A_SCHPO Ubiquitin-ribosomal protein eS31A fusion protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubi3 PE=1 SV=2
6	AFDB:P05759	0.468	0.483	1.357E-10	152	0.191	0.197	P05759.pdb.gz	RS31_YEAST Ubiquitin-ribosomal protein eS31 fusion protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RPS31 PE=1 SV=3
7	AFDB:Q1EBV4	0.485	0.188	1.752E-10	414	0.242	0.092	Q1EBV4.pdb.gz	DDI1_ARATH Protein DNA-DAMAGE INDUCIBLE 1 OS=Arabidopsis thaliana OX=3702 GN=DDI1 PE=1 SV=1
8	AFDB:P15357	0.460	0.463	2.571E-10	156	0.197	0.199	P15357.pdb.gz	RS27A_DROME Ubiquitin-ribosomal protein eS31 fusion protein OS=Drosophila melanogaster OX=7227 GN=RpS27A PE=1 SV=2
9	AFDB:P59232	0.456	0.456	4.287E-10	157	0.197	0.197	P59232.pdb.gz	R27AB_ARATH Ubiquitin-ribosomal protein eS31y fusion protein OS=Arabidopsis thaliana OX=3702 GN=RPS27AB PE=2 SV=2
10	AFDB:B9DHA6	0.449	0.549	6.705E-10	128	0.204	0.250	B9DHA6.pdb.gz	RL40A_ARATH Ubiquitin-ribosomal protein eL40z fusion protein OS=Arabidopsis thaliana OX=3702 GN=RPL40A PE=2 SV=1
11	PDB:3ai5A	0.441	0.234	3.686E-8	299	0.191	0.100	3ai5A.pdb.gz
12	PDB:6ef3u	0.436	0.872	6.984E-8	75	0.185	0.387	6ef3u.pdb.gz	Substrate-engaged 26Sproteasome structures reveal mechanisms for ATP-hydrolysis-driven translocation.
13	PDB:3dbhI	0.444	0.793	1.025E-7	86	0.172	0.314	3dbhI.pdb.gz	Structural dissection of a gating mechanism preventing misactivation of ubiquitin by NEDD8's E1.
14	PDB:6yvaC	0.443	0.448	2.507E-7	155	0.178	0.181	6yvaC.pdb.gz
15	PDB:6mdhA	0.446	0.469	4.181E-7	149	0.121	0.128	6mdhA.pdb.gz
16	PDB:4pyuA	0.442	0.884	6.540E-7	76	0.083	0.171	4pyuA.pdb.gz	The conserved ubiquitin-like protein Hub1 plays a critical role in splicing in human cells.
17	PDB:7rbsB	0.452	0.452	7.432E-7	157	0.134	0.134	7rbsB.pdb.gz	Dual domain recognition determines SARS-CoV-2 PLpro selectivity for human ISG15 and K48-linked di-ubiquitin.
18	PDB:3plvA	0.444	0.848	4.174E-6	80	0.089	0.175	3plvA.pdb.gz	Role of the ubiquitin-like protein Hub1 in splice-site usage and alternative splicing.
19	PDB:5xqmA	0.431	0.719	1.089E-5	90	0.083	0.144	5xqmA.pdb.gz
20	PDB:2lrwA	0.372	0.667	1.161E-5	78	0.140	0.282	2lrwA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P11441	3.32e-111	314	157	1.000	1.000	UBL4A_HUMAN Ubiquitin-like protein 4A OS=Homo sapiens OX=9606 GN=UBL4A PE=1 SV=1
2	B7NZQ9	1.22e-102	292	157	0.936	0.936	UBL4A_RABIT Ubiquitin-like protein 4A OS=Oryctolagus cuniculus OX=9986 GN=UBL4A PE=3 SV=1
3	B2GV38	5.51e-97	278	157	0.885	0.885	UBL4A_RAT Ubiquitin-like protein 4A OS=Rattus norvegicus OX=10116 GN=Ubl4a PE=2 SV=1
4	Q5HY81	1.29e-94	273	180	0.879	0.767	Q5HY81_HUMAN Ubiquitin-like protein 4A OS=Homo sapiens OX=9606 GN=UBL4A PE=1 SV=2
5	Q8N7F7	2.72e-35	122	174	0.427	0.385	UBL4B_HUMAN Ubiquitin-like protein 4B OS=Homo sapiens OX=9606 GN=UBL4B PE=1 SV=1
6	J3QS39	2.81e-12	61.2	93	0.191	0.323	J3QS39_HUMAN Ubiquitin B (Fragment) OS=Homo sapiens OX=9606 GN=UBB PE=1 SV=1
7	Q6FTH4	6.89e-12	61.2	128	0.191	0.234	Q6FTH4_CANGA Candida glabrata strain CBS138 chromosome G complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CAGL0G02475g PE=3 SV=2
8	P0CH08	7.11e-12	61.2	128	0.191	0.234	RL40A_YEAST Ubiquitin-ribosomal protein eL40A fusion protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RPL40A PE=1 SV=1
9	P0CH09	7.11e-12	61.2	128	0.191	0.234	RL40B_YEAST Ubiquitin-ribosomal protein eL40B fusion protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RPL40B PE=1 SV=1
10	P0CH07	7.26e-12	61.2	128	0.191	0.234	RL402_SCHPO Ubiquitin-ribosomal protein eL40B fusion protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=uep1 PE=1 SV=1
11	P0C8R3	7.83e-12	61.6	150	0.191	0.200	RS27B_SCHPO Ubiquitin-ribosomal protein eS31B fusion protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubi5 PE=1 SV=2
12	P0C016	8.34e-12	61.6	150	0.191	0.200	RS27A_SCHPO Ubiquitin-ribosomal protein eS31A fusion protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubi3 PE=1 SV=2
13	Q3E7K8	8.71e-12	62.8	230	0.191	0.130	UBQ12_ARATH Polyubiquitin 12 OS=Arabidopsis thaliana OX=3702 GN=UBQ12 PE=3 SV=1
14	Q6FSS6	8.94e-12	61.2	152	0.191	0.197	Q6FSS6_CANGA Candida glabrata strain CBS138 chromosome G complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CAGL0G08173g PE=3 SV=1
15	Q8RUC6	9.79e-12	61.2	154	0.185	0.188	RUB2_ARATH Ubiquitin-NEDD8-like protein RUB2 OS=Arabidopsis thaliana OX=3702 GN=RUB2 PE=1 SV=3
16	Q5ADS0	9.84e-12	62.8	229	0.191	0.131	UBI4P_CANAL Polyubiquitin OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=UBI4 PE=3 SV=1
17	P05759	9.93e-12	61.2	152	0.191	0.197	RS31_YEAST Ubiquitin-ribosomal protein eS31 fusion protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RPS31 PE=1 SV=3
18	P49632	1.03e-11	60.8	128	0.191	0.234	RL40_CAEEL Ubiquitin-ribosomal protein eL40 fusion protein OS=Caenorhabditis elegans OX=6239 GN=ubq-2 PE=3 SV=2
19	Q9SHE7	1.17e-11	61.2	156	0.185	0.186	RUB1_ARATH Ubiquitin-NEDD8-like protein RUB1 OS=Arabidopsis thaliana OX=3702 GN=RUB1 PE=1 SV=3
20	P15357	1.24e-11	61.2	156	0.191	0.192	RS27A_DROME Ubiquitin-ribosomal protein eS31 fusion protein OS=Drosophila melanogaster OX=7227 GN=RpS27A PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11069 CFAP298	3.8e+02	12.9	Cilia- and flagella-associated protein 298
2	PF10302 Dsc3_N	28	16.7	DSC E3 ubiquitin ligase complex subunit 3, ubiquitin-like domain
3	PF11976 Rad60-SLD	7.1e-06	37.1	Ubiquitin-2 like Rad60 SUMO-like
4	PF18396 TBK1_ULD	1.7e+02	13.5	TANK binding kinase 1 ubiquitin-like domain
5	PF17840 Tugs	6.1e-22	88.8	Tethering Ubl4a to BAGS domain
6	PF00240 ubiquitin	5.9e-17	72.5	Ubiquitin family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000358674

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000265857	0.999	Golgi to ER traffic protein 4 homolog
2	9606.ENSP00000365131	0.999	Large proline-rich protein BAG6
3	9606.ENSP00000221566	0.998	Small glutamine-rich tetratricopeptide repeat-containing protein alpha
4	9606.ENSP00000466379	0.994	ATPase ASNA1
5	9606.ENSP00000327716	0.950	Tail-anchored protein insertion receptor WRB
6	9606.ENSP00000370395	0.926	Small glutamine-rich tetratricopeptide repeat-containing protein beta
7	9606.ENSP00000261942	0.920	FAS-associated factor 2
8	9606.ENSP00000297156	0.886	Calcium signal-modulating cyclophilin ligand
9	9606.ENSP00000292363	0.876	E3 ubiquitin-protein ligase RNF126
10	9606.ENSP00000340648	0.842	E3 ubiquitin-protein ligase HUWE1
11	9606.ENSP00000377192	0.814	Glucose-6-phosphate 1-dehydrogenase
12	9606.ENSP00000263966	0.790	Ubiquitin carboxyl-terminal hydrolase 13
13	9606.ENSP00000294179	0.783	Syntaxin-5
14	9606.ENSP00000341625	0.779	Cytochrome b5
15	9606.ENSP00000223641	0.762	Protein transport protein Sec61 subunit beta
16	9606.ENSP00000290649	0.756	E3 ubiquitin-protein ligase AMFR
17	9606.ENSP00000383719	0.746	Ubiquitin-conjugating enzyme E2 J2
18	9606.ENSP00000351777	0.743	Transitional endoplasmic reticulum ATPase
19	9606.ENSP00000420076	0.733	Stress-associated endoplasmic reticulum protein 1
20	9606.ENSP00000388337	0.723	Protein transport protein Sec61 subunit gamma

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.622	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0019538	0.978	protein metabolic process
GO:0044260	0.975	cellular macromolecule metabolic process
GO:0065007	0.967	biological regulation
GO:0090150	0.938	establishment of protein localization to membrane
GO:0070972	0.921	protein localization to endoplasmic reticulum
GO:0009056	0.917	catabolic process
GO:0019941	0.909	modification-dependent protein catabolic process
GO:0045048	0.890	protein insertion into ER membrane
GO:0006612	0.870	protein targeting to membrane
GO:0072599	0.855	establishment of protein localization to endoplasmic reticulum
GO:0045047	0.841	protein targeting to ER
GO:0050789	0.600	regulation of biological process
GO:0050794	0.546	regulation of cellular process
GO:0036211	0.533	protein modification process
GO:0006511	0.473	ubiquitin-dependent protein catabolic process
GO:0031647	0.470	regulation of protein stability
GO:0048518	0.306	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005654	0.999	nucleoplasm
GO:0016020	0.996	membrane
GO:0032991	0.988	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]